SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011737 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011737
Domain Number 1 Region: 7-351
Classification Level Classification E-value
Superfamily Sema domain 3.79e-89
Family Sema domain 0.000098
Further Details:      
 
Domain Number 2 Region: 354-406
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000824
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 1585-1657
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000212
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 4 Region: 904-984
Classification Level Classification E-value
Superfamily E set domains 0.00000241
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.068
Further Details:      
 
Domain Number 5 Region: 981-1070
Classification Level Classification E-value
Superfamily E set domains 0.0000042
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011737   Gene: ENSVPAG00000002387   Transcript: ENSVPAT00000015456
Sequence length 1737
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3628:328560:676519:-1 gene:ENSVPAG00000002387 transcript:ENSVPAT00000015456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHYLSGVNESGSVFGVIVSYSNLDDKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAY
VFHDEFVASMIKIPSDTFTVIPDFDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVY
TSKLVRLCKEDTAFNSYVEVPIGCERSGVEYRLLQAAYLSKAGAVLARTLGVRPEDDLLF
TVFSKGQKRKMKSLDESALCIFILKQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSA
LLTIDDNFCGLDMNAPLGVSEMVRGIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLK
KIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYRSC
SECLGSGDPHCGWCVLHNTCTRKERCERSREPRRFASEMKQCVRLTVHPSNISVSQYNVL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXAVWGTHLDLIQNPQIRAKHGGKEHINLCEVLNATEMTCQAPALALGPDHHSDLTEREE
FGFILDNVQSLLILNKTNFTYYPNPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNV
RLNYTVLIGEKPCTVTVSDVQLLCEAPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLP
AIVSIAVAGGLLIVFIVAVLIAYKRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFAELQ
TDIHELTSDLDGAGIPFLDYRTYTIRVLFPGIEDHPVLRDLEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECAGEPLFSLFCAIKQQMEKGPIDAI
TGEARYSLSEDKLIRQQIDYKTLVLSCVNPDNANSPEIPVKILNCDTITQVKEKILDAIF
NNVPCSHRPKAANMDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXNMIRYTGSPDSFRSRTPMITPDLESGVKMWHLVKN
HEHGDQKEGDRGSKMVSEIYLTRLLATKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQT
FMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences ENSVPAP00000009773 ENSVPAP00000011737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]