SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000192 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000192
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily L domain-like 5.44e-35
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 154-257
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000274
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000192   Gene: ENSVPAG00000000208   Transcript: ENSVPAT00000000208
Sequence length 1235
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2065:46083:131217:-1 gene:ENSVPAG00000000208 transcript:ENSVPAT00000000208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNRIGCLNA
DIFRGLTNLVRLNLSGNLFSSLSQGTFDYLGSLRSLEFQTEYLLCDCNILWMHRWVKERN
ITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMA
SYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIHNCSLIASALTISNIQAGSTGNWGCHV
QTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGDFXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPLNLTNAVATARQLLA
YTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLGLAQR
EARACSRIVQCLQRIATYRLANGAHVYSTYSPNIALEAYVIKATGFTGMTCTVFQKVAAA
DRTGLSDYGRRDLDGNLDKQLSFKCNVSNTFSSLALKNTIVEASIQLPPSLFSPKHKREV
RPSDDSLCKLQLIAFRNGKLFPATGNSTKLADDGKRRTVVTPVILTKIDGVNVDTHHIPV
NVTLRRIAHGADAVAAQWDFDLLNGQGGWKSDGCHILYSDENITTMQCYSLSNYAVLMDL
TGSDLYTQAASLLHPVVYTTAVILLLSLSVVLVSYIFHHSLIRISLKGWHMLVNLCFHIF
LTCVVFVGGITQTRNASVCQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFYLIGGGIPIIVCGITAAANIKNYGSRPNAPYCWMAWEPSLGAFYGPASF
ITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEVSHQDSMSLSLISTSAL
ENEHTFHAQLLGASLTLLSYVALWLFGALAVSLYYPLDLVFSFFFGATCLSLSAFVVVHH
CVSREDVRLAWIMTCCPGRSSYSVQVNVQPPSSSGPSGEAPKCTNSSAESSCTNKSASSF
KNSSQGCKLTNLQAAAAQCQTNSLPLNATPQLDNSLTEHSMDNDIKMHVAPLEVQFRTNV
HPGRHHKNRSKAHRASRLTVLREYAYDVPTSVEGSVQNGLPKSRPAGGEGHSRSRRAYLA
YRERQCNPPQQDSSDAGSTLPKSGRNFDKPVSTSSKKDAPRKPTVVELEGQQKSYGLNLA
IQNGPVKSNGQDGPLLGTDSTGNVRTGLWKHETTV
Download sequence
Identical sequences ENSVPAP00000000192 ENSVPAP00000000192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]