SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000971 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000971
Domain Number 1 Region: 19-283
Classification Level Classification E-value
Superfamily Sema domain 2.35e-85
Family Sema domain 0.00000423
Further Details:      
 
Domain Number 2 Region: 327-481
Classification Level Classification E-value
Superfamily Sema domain 1.39e-36
Family Sema domain 0.00032
Further Details:      
 
Domain Number 3 Region: 477-525
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000155
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000971   Gene: ENSVPAG00000001055   Transcript: ENSVPAT00000001055
Sequence length 1010
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2833:454576:522596:-1 gene:ENSVPAG00000001055 transcript:ENSVPAT00000001055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKQYPVFVGHKPGRNTTQRHRLDIQMILIMNRTLYIAARDHIYTVDIDTSHTEEIYCSKK
LTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYKMDTLEP
FGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVLDSW
LKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVKNDMGGSQRVLEKQWTSFL
KARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPGCCAGSSSLERYATSNEFPDDTLNFIKTHPL
MDEAVPSIINRPWFLRTMVRYRLTKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNS
GFLNDSLFLEEMSVYNPEKCSYDGVEDKRIVGMQLDKASSSLYVAFSTCVIKVPLGRCER
HGKCKKTCIASRDPYCGWVKEGGACAHLSPGSRLTFEQDVERGNTDGLGDCHNSFVALND
ISTPLPDHEMSYNTVYGHSSSLLPSTTASDSAAQEGYESRGGMLDWKDLLNSPDSTDSLG
AVSSHNHQDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXKLQCGGREWERNQNLINACTKDMPPMGSPVIP
TDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQMALEDQAATLEYKTIKEHLS
SKSPNHGVNLVENLDSLPPKVPQREASLGPPGASLSQNGLSKRLEMHHSSSYGLDYKRSY
PTNSLTRSHQAATLKRNNTNSSNSSHLSRNQSFGRGDNPPPAPQRVDSIQVHSSQPSGQA
VTVSRQPSLNAYNSLTRAGLKRTPSLKPDVPPKPSFAPLSTSMKPNDACT
Download sequence
Identical sequences ENSVPAP00000000971 ENSVPAP00000000971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]