SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001808 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001808
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 6.8e-49
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 278-315
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000225
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001808   Gene: ENSVPAG00000001956   Transcript: ENSVPAT00000001956
Sequence length 636
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3564:318031:335137:1 gene:ENSVPAG00000001956 transcript:ENSVPAT00000001956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPI
NLQHLILSGNQLGRIAPGAFDDFLDSLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLSQLSRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGKPVPTMHWVGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPASSHHFLLKHLVPGADYDLCLLALSPA
AGPSDLTATRLLGCAHFSTLPATPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGNGRLPLKLSHVQSQTNGGPSPTPKVHPPRSPPPRPQRSCSLDLRDTGGCYGYARR
LGGAWARRSHSVHGGLLTAGCRGVGGSAERLEESVV
Download sequence
Identical sequences ENSVPAP00000001808 ENSVPAP00000001808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]