SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001857 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001857
Domain Number 1 Region: 481-738
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-81
Family Kelch motif 0.00000109
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily POZ domain 1.54e-32
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001857   Gene: ENSVPAG00000002011   Transcript: ENSVPAT00000002011
Sequence length 742
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_824:18359:80763:1 gene:ENSVPAG00000002011 transcript:ENSVPAT00000002011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVIYFPFNLFIVYSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEFDVKQIL
KIRWRWFSHQASSPNSTVDSQQGEFWNRGQTRANGGRKFLDSCSLQLPLASIGYRRSSQL
DFQNSPSWPMASTSEVPAFEFTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSNSSQ
TLSSCHTMEPCSSDEFFQALNHAEQTFKKMENYLRHKQLCDVILVAGDRRIPAHRLVLSS
VSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYTGRLELKEDNIECLLSTACLL
QLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEVIRNQEFVL
LPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLLAPQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ATSIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKT
WSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRST
VGVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRGGVGVTTWNGLLYAI
GGHDAPTSNLTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLLGDKLYAVGGYDGQT
YLNTVEAYDPQTNEWTQVFSSF
Download sequence
Identical sequences ENSVPAP00000001857 ENSVPAP00000001857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]