SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002101 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002101
Domain Number 1 Region: 73-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.79e-34
Family Canonical RBD 0.0000222
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002101
Domain Number - Region: 15-58
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0549
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002101   Gene: ENSVPAG00000002272   Transcript: ENSVPAT00000002272
Sequence length 470
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1908:8686:15220:1 gene:ENSVPAG00000002272 transcript:ENSVPAT00000002272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSNKTFNLEKQNHTPRKHHQHHHQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKN
FRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTL
AEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIV
DDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLV
IKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEME
AARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEE
MMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMP
DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Download sequence
Identical sequences A0A2K6ELV8 F1PTP3 F6UBF6 G1MC92 I3MQH7 K9IVQ3 M3Y0P7
ENSCAFP00000025137 ENSMPUP00000004898 ENSTTRP00000009104 ENSTTRP00000009104 ENSAMEP00000016970 ENSCAFP00000025137 ENSAMEP00000016970 ENSVPAP00000002101 ENSECAP00000006689 ENSMPUP00000004898 XP_001492850.1.31192 XP_001492878.1.31192 XP_004000663.1.62641 XP_004439906.1.5094 XP_004439907.1.5094 XP_004777287.1.14098 XP_005340005.1.77405 XP_005614311.1.31192 XP_005641524.1.84170 XP_006217709.1.17985 XP_007122148.1.24612 XP_007122149.1.24612 XP_007470158.1.90284 XP_008565774.1.73410 XP_008710472.1.72690 XP_008710473.1.72690 XP_010971903.1.22495 XP_010977060.1.51371 XP_011235349.1.58354 XP_012390630.1.21590 XP_012390631.1.21590 XP_012390632.1.21590 XP_012498740.1.63892 XP_012498745.1.63892 XP_012903680.1.14098 XP_014419053.1.101512 XP_014584443.1.31192 XP_014693183.1.49734 XP_014693184.1.49734 XP_019284227.1.44245 XP_019284228.1.44245 XP_019284229.1.44245 XP_019284230.1.44245 XP_019679508.1.62641 XP_019804609.1.83887 XP_019804610.1.83887 XP_019804611.1.83887 XP_021536265.1.83697 XP_021536286.1.83697 XP_021536293.1.83697 XP_021536303.1.83697 XP_021536311.1.83697 ENSECAP00000006689 9796.ENSECAP00000006689 ENSVPAP00000002101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]