SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002366 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002366
Domain Number 1 Region: 341-599
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-39
Family Kelch motif 0.00093
Further Details:      
 
Domain Number 2 Region: 41-166
Classification Level Classification E-value
Superfamily POZ domain 3.73e-33
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002366   Gene: ENSVPAG00000002563   Transcript: ENSVPAT00000002563
Sequence length 680
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1092:41336:43378:-1 gene:ENSVPAG00000002563 transcript:ENSVPAT00000002563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSREEAPRSRRLASPRGGRRPKRISKPSVSAFFTGPKELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMFESQQTNVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFA
DAFDHHKLRSQAQSFIAHNFKQLSRMGSIREESLADLTLAQLLAVLRLDSLDIESERTVC
HVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDQDYLEGLLTKPIVKKYCLDLIEGALQ
LRYGDMLYKSLVPKPESSSGSSVVSIAENPPQRLGMCAKEMVIFFGHPRDPFLCYDPYSG
DIYTMPSPLTSLAHTKTITSSAVCVSPEHDIYLAAHPRKDLWVYKPAQNSWQQLADRLLC
REGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQN
YLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEW
RRISNIPLDSETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGL
LQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSD
DEVWVQVAPQRNAQDQQGSL
Download sequence
Identical sequences ENSVPAP00000002366 ENSVPAP00000002366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]