SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002588 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002588
Domain Number 1 Region: 994-1077
Classification Level Classification E-value
Superfamily PH domain-like 6.35e-23
Family Pleckstrin-homology domain (PH domain) 0.0000108
Further Details:      
 
Domain Number 2 Region: 781-899
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-21
Family DBL homology domain (DH-domain) 0.000000618
Further Details:      
 
Domain Number 3 Region: 42-121
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000141
Family PDZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 349-379
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000647
Family Regulator of G-protein signaling, RGS 0.00061
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002588
Domain Number - Region: 148-158
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00942
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002588   Gene: ENSVPAG00000002787   Transcript: ENSVPAT00000002796
Sequence length 1170
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1378:9469:157005:-1 gene:ENSVPAG00000002787 transcript:ENSVPAT00000002796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSLGDSAPERKSPSHHRQPSDTSEATGLVQRCVIIQKDQHGFGFTV
SGDRIVLVQSVRPXXXXXXXXXXXXXXXXXVNGTMVTDRSHLEVVKLIKSGAYVALTLLG
SSPSSIGVSGSQQDPAPAGTPRVTPVIPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQI
LRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDTLPLYG
DTSQRSSEGRFSLDSQEGDSGLDSGTERFPSLGESLMNRNSVLSDPGLDSPRTSPVIMAR
TAQHHRRQGSDAPVLPSSDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDFEKLKSRP
AHLGVFLRYIFSQADPSPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAPMDFALNTYMSHAGIRLREPRPSNTTEKAQS
APDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVK
PGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LFVTEASHLRTLRVLDLIFYQRMKKEGLLPREELARLFPNLPELIEIHNSWCEAMKRLRE
EGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTRQRKESRFQLFMQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLDLTTRKMIHEGPLTWRISKDKT
LDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGAVDSKQTFSPVLKLNAVLVRSVATXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVGLDDSEVFHSGPEPEVLPG
Download sequence
Identical sequences ENSVPAP00000002588 ENSVPAP00000002588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]