SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002590 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002590
Domain Number 1 Region: 262-349,555-592
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.27e-43
Family Inhibitor of apoptosis (IAP) repeat 0.00000299
Further Details:      
 
Domain Number 2 Region: 175-251
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.45e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000802
Further Details:      
 
Domain Number 3 Region: 37-117
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.11e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 454-550
Classification Level Classification E-value
Superfamily DEATH domain 1.32e-21
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002590   Gene: ENSVPAG00000002800   Transcript: ENSVPAT00000002799
Sequence length 617
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1591:261365:274788:1 gene:ENSVPAG00000002800 transcript:ENSVPAT00000002799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKTTSQSLIPGPSYQKISMMEDSTVLSDWTIGNKQKMKYDFSCELYRMSTYSTFPTGVPV
SERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDNPIEKHKKLYPSCSFIQSLVTVTNL
ESTPKNASPMRNSSGHSLSPTLEHSSSFSGSYSSLSSKPVNSRAVENFSSLRTNPYSYAM
STEEARFLTYQMWPLTFLSPSELARAGFYYIGPGDRVACFACGGTLSNWEPKDDAMSEHR
RHFPNCPFLENSLEMQRFSISNLSMQTSAVRLRTFMYWPSAVPVQPDQLAIAGFYYVGRN
DDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEVQARYPHLLEQLLS
TSDTPGDENSDPPIVHFGPGESSSEDAVMMSTPVVKAALEMGFSRSLIKRTVQSKILTTG
ENYKTVNDIVSALLNAEDEKREEEKERQTEEVASGDLSLIRKNRMALFQQLTCVLPILDN
LLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNCAANIFKNCLKEIDSTLYENLFV
EKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRK
CPICRGIIKGTVRTFLS
Download sequence
Identical sequences ENSVPAP00000002590 ENSVPAP00000002590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]