SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002858 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002858
Domain Number 1 Region: 341-630
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-58
Family Kelch motif 0.0000599
Further Details:      
 
Domain Number 2 Region: 69-189
Classification Level Classification E-value
Superfamily POZ domain 8.63e-32
Family BTB/POZ domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002858
Domain Number - Region: 270-349
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0994
Family B3/B4 domain of PheRS, PheT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002858   Gene: ENSVPAG00000003091   Transcript: ENSVPAT00000003091
Sequence length 652
Comment pep:known_by_projection scaffold:vicPac1:scaffold_3578:37087:91919:-1 gene:ENSVPAG00000003091 transcript:ENSVPAT00000003091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGSSEMGLSSHLQS
SKAGTTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFK
AMFTGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVL
DFCKVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFERL
AFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVD
FMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELR
MYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK
WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELXXXXXXXXXXXXXXXXXXXXXLQCG
GIYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGGN
HFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMV
EIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
Download sequence
Identical sequences ENSVPAP00000002858 ENSVPAP00000002858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]