SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002940 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002940
Domain Number 1 Region: 922-1012
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-25
Family PDZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 534-636
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-24
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 3 Region: 438-533
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-18
Family Second domain of FERM 0.0012
Further Details:      
 
Domain Number 4 Region: 776-850
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-17
Family PDZ domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002940
Domain Number - Region: 75-161
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00221
Family Protein kinases, catalytic subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002940   Gene: ENSVPAG00000003174   Transcript: ENSVPAT00000003180
Sequence length 1296
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2710:101986:246020:-1 gene:ENSVPAG00000003174 transcript:ENSVPAT00000003180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLTQDPGMSPASVTLASVLQVRGEALSEEEIWSLLSLAAERLLEDLRDDSSDYVVCPW
SALLSAAGSLSFQDHISHIEAAPFKAPELLQGQSDAEQPDASQMHVYSLGMTLYWSAGFH
VPPNQPLQLCEPLHSILLTMCEDQPCRRLSLPSILEACRVHWEEVTVYPASANLHIRQLV
GMVLGTTSQVERRAVEESSSGQRDRSYLLRNRLHQASRESPAAQVLGCLHPCRVSERNTE
TQSSPEPRLSAAAYSHCSLSVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEFFFLDAETRLCKIAPEGWSEQPQKRSTP
KTFTLFLRIKFFVSHCGLFPQLRKDILEERLYCNDEMLLQLGVLALQAEFGSYPEEQVEN
KAYFRVEDYIPASLIERMTALQVQAEVSEMHRLSPVLWGEDAELEFLRVTQQLPEYGVLV
YQVLPEKTRPEGEMALGICAKGVIVYEVRNNSRIATLRFQWREIEKILAYRKKFIITSSI
TGKKHTFVTDSAKTCKYLLGLCCAQHGFNAQMSSPGVTPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCLGREQLEN
MCLIQKPTTCDPLSGLPVRSMCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVIHE
GEDVGKVVPGIFISSIIPGGPAEKAKKIKPGGQILALNHISLEGFTFDMAVRMIQNSPDN
VELIISQSRGVCGNTSSEEKKSTANSRVCSTDSLSDGHRGGLPSHTQDQERVSEELGMAR
TQRLMPGMRPRLSTLPLKDAGSRPSSPSETNASEIYFVELVKEDGTLGFSVTGGINTSVP
CGGIYVKSIVPGGPAAKEGRILQGDRLLQVDGVSLCGLTHKQAVQCLKGSGQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVLHLLR
GASQEVTLLLCRPPPGTLPEMDQGWQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXFSFSSSLTRLSTDIS
Download sequence
Identical sequences ENSVPAP00000002940 ENSVPAP00000002940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]