SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003652 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003652
Domain Number 1 Region: 367-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-17
Family MAM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 44-171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000926
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 170-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000658
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003652   Gene: ENSVPAG00000003927   Transcript: ENSVPAT00000003929
Sequence length 505
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1642:331021:415151:1 gene:ENSVPAG00000003927 transcript:ENSVPAT00000003929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALVLGSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARRSWGQCQPVC
QPQCHGECIGPNCKCHPGYAETCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLSGYMLLP
DGSCSGALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVHDIYECSLGQYQCSS
FARCYNVHGSYKCKCKDGNSYVGWNCVYIPKVMIEPSGPIHLPRGNGTISKGDGGHSNWI
PDVRSTRWPLKTPYVPPVITNRPTSKPTRPTPEPMTATPLTPPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEFCGWIREKDSDLHWEPVRDPAGGQYLTVSAAKGPAGKAARLVLPLGHRLHSGD
LCLSFRHKVAGLRSGTLQVFVRKHGAHGAALWGRNGGHGWRQTHITLRGADVKSVIFKGE
KRRGHGEIGLDDVSLKKGQCSEERE
Download sequence
Identical sequences ENSVPAP00000003652 ENSVPAP00000003652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]