SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003693 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003693
Domain Number 1 Region: 257-481
Classification Level Classification E-value
Superfamily Sema domain 1.96e-75
Family Sema domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 4-184
Classification Level Classification E-value
Superfamily Sema domain 8.89e-52
Family Sema domain 0.00000534
Further Details:      
 
Domain Number 3 Region: 477-531
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000204
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003693   Gene: ENSVPAG00000003976   Transcript: ENSVPAT00000003976
Sequence length 584
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3219:589095:681329:-1 gene:ENSVPAG00000003976 transcript:ENSVPAT00000003976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLDLNRTSVFHSPFGFLDLHSMLLDEYQERLFVGGKDLVYSLSLENISSGYREIHWPSTA
LKTEECIMKGKDASECANYVRVLHHYNRTHLLTCGTGAFDPLCAFIRVGYHLEDPLFHLE
SHRSERGRGRCPFDPSSSFISTLIGSELFAGLYSDYWGRDAAIFRTMGRLAHIRTEHDDE
RLLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSVPGMNGDTYDELEDVFLLHTRDHKNPVIFGLFNTTSNIFRGHAI
CVYHMSSIRAAFNGPYAHKEGPEYHWSLYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDA
IRFARGHPLMYQPIKPAHKKPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVL
KVITIYNQETESMEEVILEELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHQCDM
YGSACADCCLARDPYCAWDGISCSRYYPTGIHAKRRFRRQDVRHGNAAQQCFGQQFVGDA
LDKTEERLAYGIENNSTLLECTPRSLQAKVIWFVQKGRDTRKEE
Download sequence
Identical sequences ENSVPAP00000003693 ENSVPAP00000003693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]