SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003725 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003725
Domain Number 1 Region: 316-511
Classification Level Classification E-value
Superfamily Kelch motif 7.45e-56
Family Kelch motif 0.0000141
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily POZ domain 9.94e-32
Family BTB/POZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003725   Gene: ENSVPAG00000004009   Transcript: ENSVPAT00000004009
Sequence length 511
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2384:341844:367444:-1 gene:ENSVPAG00000004009 transcript:ENSVPAT00000004009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASESLNAKQARNRLTKGKRQQHQQIKNRSSVSDGDGEDSFIFEANEAWKDFHGSLLQFY
ENGDLCDVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDGDAIEDL
VKFVYSSRLTLTVDNVQPLLYAACILQVELVARACCEYMKLHFHPSNCLAVRAFAESHNR
IDLMDMADQYACEHFTEVVECEDFVSVSPQHLHKLLSSSDLNIENEKQVYSAAIKWLLAN
PQHHSKWLDETLAQVRLPLLPVDFLMGVVAKEQIVKQNLKCRDLLDEARNYHLHLSSRAV
PDFEYSIRTTPRKHTAGVLFCVGGRGGSGDPFRSIECYSINKNSWFFGPEMNSRRRHVGV
ISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGGL
DDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVALVNHVYAVGGNDGVASLSSVERYD
PHLDKWIEVKEMGQRRAGNGVSELHGCLYVV
Download sequence
Identical sequences ENSVPAP00000003725 ENSVPAP00000003725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]