SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003761 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003761
Domain Number 1 Region: 924-1053,1227-1333
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2e-25
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 2 Region: 325-376
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000432
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 234-323
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000405
Family Sema domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000003761
Domain Number - Region: 540-626
Classification Level Classification E-value
Superfamily E set domains 0.00028
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 
Domain Number - Region: 629-700
Classification Level Classification E-value
Superfamily E set domains 0.00484
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003761   Gene: ENSVPAG00000004047   Transcript: ENSVPAT00000004048
Sequence length 1443
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1526:60703:241599:1 gene:ENSVPAG00000004047 transcript:ENSVPAT00000004048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FACLSFYQETSIVRPCNQSLISVCSGTEVVSHPQGSTAGVVYRVGFQNRWYLAVAATYVL
PEPETANLRNPAASDRDTAIALKNTEGRSLATEEMGRLKLREGGGSLHFVDALWNGSVXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEGEQPERVQPI
ASSTIHSDTSVYGTVLNRTVVFVGTRDGQLLKVILGENLTSNCPEVIYEIKEETPVFYKL
VPHPEKNIYIYLTAGKEVRRIRVANCSKHESCLECLAAADPYCGWCHSLQRCTFKEDCVH
LKNSENWLDISSGAKKCPQIHLFRSSRDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVLIVNVTVSFGSWHLSKRFNFTNCSSLRECPVCIGTGCAWC
KSERKCIHPFTACDPSDYKTNQELCTVAFEKWAPPKTVGGGRYKENKSNRTNQRLQVFYI
KSIEPQKISTLGKSNVIVTGANFTQASNITMILKGTSTCDKDVIQVRHVLNDTHMKFSLP
SSRKEMKDVCIQFDGGNCSSVGPLSYIALPHCSLIYPATTWISGGQNITIMGRNFDVIDN
LIISHEPKENESVSEYCKATHCRFSAPTLSSKGRTNVTVKLRVQETYLDCGSLQYLDDPR
FTGYRAEPEVDTELEVKIQKENDNFNISREDIEITLFYGKGEKLNCTFENITRNQDLTTI
FCKINGITAANSIAASSKKVLVKLGNLELFVERESVLSTWYFLIGLPILLVIVIFVAVGV
TRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRT
FFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFSVKDRC
LFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCL
SGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALTVVF
EKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQVGTR
HKELLDIDSSSVILEDGITKLNTIGHYEXXXXXXXXXXXXXXXXXXXVEYSEDHCHLILP
DSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIK
YFFDFLDAQAESKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSVI
AQAFMDAFSLTEQQLGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNKLERERGLEEAQKQLLHVKVLFDEKKKC
KWM
Download sequence
Identical sequences ENSVPAP00000003761 ENSVPAP00000003761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]