SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003770 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003770
Domain Number 1 Region: 325-565
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-71
Family Kelch motif 0.000000000329
Further Details:      
 
Domain Number 2 Region: 51-174
Classification Level Classification E-value
Superfamily POZ domain 1.41e-29
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003770   Gene: ENSVPAG00000004060   Transcript: ENSVPAT00000004059
Sequence length 565
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_358:84881:149600:-1 gene:ENSVPAG00000004060 transcript:ENSVPAT00000004059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQQEPRPSGAGAHPLFPLSSQRPEGAGDTVMNTTGGKTEVTSQHGNRTFSYTREDHTKQA
FGIMNELRISQQLCDVTLQVKYEDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVV
SIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSN
AIGIANFAEQIGCAELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVRCES
EVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPHFLQMQLQKCEILQSDSRCKDYLAK
IFQELTLHKPTQMMPCRAPKVGRLIYTAGGYFRKLSYLEAYNPSDGTRLRLADLQVPRSG
LAGCVVGGLLYAVGGRNNSPDGNTDSNALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGH
IYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRL
NSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETW
TFVAPMKHRRSALGITVHQGKIYVL
Download sequence
Identical sequences ENSVPAP00000003770 ENSVPAP00000003770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]