SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004198 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004198
Domain Number 1 Region: 47-253
Classification Level Classification E-value
Superfamily L domain-like 1.91e-31
Family Ngr ectodomain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 247-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000246
Family I set domains 0.088
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000004198
Domain Number - Region: 284-313,403-433
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0624
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004198   Gene: ENSVPAG00000004522   Transcript: ENSVPAT00000004522
Sequence length 552
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3483:3880:7902:-1 gene:ENSVPAG00000004522 transcript:ENSVPAT00000004522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVSHCFLLVLVFLDSLAAQPSCLPGCTCSEESFGRPLQCVSFSLGKIPRNLSEEFKQV
RIENSPLFELPRGSFINMSTLEYLWLNFNNVTVIHVGALEHLSELKELRLEGNKLRSVPW
TAFHATPLLRVLDLKHNWIDVLPELALQFLGNLTYLDLSSNRLTVVSKSVFLNWPAYQKH
RQPGCGAEILSSMVLALHDNPWLCDCRLRGLVQFVKSISLPLILVNPYLMCRGPLSKAGQ
IFQETELSTCLKPQMSTPSANVSIQVGQNVTLQCLAQANPLPTVAWTYPLSMWRKFDVLT
SSTAEDAAMSELVIPAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTLYIASDEAFRKEVVHVGPGINTYAV
DDLLPGTKYEACLSLGGQPPRQGRCVVFVTGRDHGGLEGRERLLHTTVVLCAVLLAVPVG
AYVWAAQAPCSCREWGLRCCPHCTKAPRCPRAVPQHSDGSYRDHTAVSEDGLGYRGAEGV
GNKEKDGEGESG
Download sequence
Identical sequences ENSVPAP00000004198 ENSVPAP00000004198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]