SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004377 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004377
Domain Number 1 Region: 50-511
Classification Level Classification E-value
Superfamily Sema domain 4.19e-136
Family Sema domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 507-556
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000192
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004377   Gene: ENSVPAG00000004719   Transcript: ENSVPAT00000004719
Sequence length 1066
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1602:642999:656309:1 gene:ENSVPAG00000004719 transcript:ENSVPAT00000004719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLLCAYMLLLMVPQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEIPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLNTLEYDGEEISGRYPSLARCPFDARQTNVA
LFADGKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFF
FREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDV
LQSITDIIQINDVPTVVGVFTTLNAFSMDDIEKVFKGRFKEQKTPDSVWTAVPEDKVPKS
LPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRIRYRLTAVA
GAHAAGPHQNYTVINGSEAGVVLKIAKTSPFSLNDSVLLEEIEAYNHAKCSAENEEDRKV
ISLQLDKDHHALYVAFSSCVIRIPLSRCERYGSCKKTCIASRDPYCGWLSQGACGLVTPG
TLAGGFEQDTEYGNTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTAMASIPEIT
PKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQSGESNQMVHMNVLITC
VFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKDAESAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQMARQTL
MLDPVGPLSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLERQRGYHKN
SSQRHSISAMPKNLTSPNGVLLSRQPSMNRGGYMATPTGAKVDYIQGTPVSVPLQPPLSR
QSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTTPVRPLNKYTY
Download sequence
Identical sequences ENSVPAP00000004377 ENSVPAP00000004377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]