SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004382 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004382
Domain Number 1 Region: 2221-2293
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1942-2011
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.49e-18
Family TB module/8-cys domain 0.00000692
Further Details:      
 
Domain Number 3 Region: 1736-1863
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 336-466
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 2280-2418
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-17
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 6 Region: 427-547
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.69e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 7 Region: 2019-2136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.15e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 616-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 1574-1640
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000314
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 10 Region: 737-821
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000445
Family TB module/8-cys domain 0.0025
Further Details:      
 
Domain Number 11 Region: 542-612
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000051
Family TB module/8-cys domain 0.0012
Further Details:      
 
Domain Number 12 Region: 2378-2497
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000126
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 13 Region: 922-1006,1074-1132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 14 Region: 1494-1543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000816
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 15 Region: 194-275
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000105
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 16 Region: 1170-1224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 17 Region: 1860-1912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000069
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 18 Region: 1300-1411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000942
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 19 Region: 1129-1179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 20 Region: 1903-1944
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 21 Region: 2182-2238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 22 Region: 1049-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 23 Region: 1536-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000296
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 24 Region: 1699-1734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000035
Family EGF-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000004382
Domain Number - Region: 95-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000729
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 61-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0902
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004382   Gene: ENSVPAG00000004724   Transcript: ENSVPAT00000004725
Sequence length 2714
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1602:1297343:1535590:-1 gene:ENSVPAG00000004724 transcript:ENSVPAT00000004725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRS
IQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGP
QCERDYRTGPCFTVISNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVTQKCEDIDECSTI
PGICDGGECTNTVSSYFCKCPPGFYTSPDGTRCIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXDFNKLCSGVLPVNITDYCQLFRYLCQNGRCIP
TPGSYRCECNKGFQLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRPGYQSTLTRTE
CRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMC
INEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGL
DGRVCVDTHMRSTCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEY
QALCSSGPGITSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDIN
ECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGS
FICECSSESTLDPTKTICIETIKGTCWQTIINGRCEININGATLKSQCCSSLGAAWGSPC
TPCQLDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPSGMTLDATG
RICLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERN
CTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXINECELSAHLCPHGRCVNLIGKYQCACNPGYH
STPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPN
ICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHC
EMGYSGKKGKTGCTDINECEIGAHNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDECSENLNLCGNGQCLNAPGGY
RCECDMGFVPSADGKACEDDERSPPNFVFRTCHNLPGLFRCECEIGYELDRSGGNCTDVN
ECLDPTTCISGNCVNTPGSYCDCPPDFELNPTRVGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYKILCPGGEGFRPNPITVILEDIDEC
QELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNY
TCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFTMTQKMCCCSYNIGRAWN
KPCEHCPIPSTDEFATLCGSQRPGFVIDIYTGLPVXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDR
NECQEIPNICSHGQCIDTVGSFYCICHTGFKTNADQTMCLDINECERDACGNGTCRNTIG
SFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRT
CVDINECLLEPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCS
NTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGE
GWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYR
CECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINEC
AQNPLLCAFRCVNTYGSYECKCPAGYVLREDRRMCKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDE
CLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLC
PHGRGFMTNGADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQ
APKPCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCK
CPPGFTQHHTACIDNNECTTDINLCGAKGICQNTPGSFTCECQRGFSLDQTGASCEDVDE
CEGNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCVSGM
GMGRGNPEPPASSEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDAFLIEHNRYLIES
GNENGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGE
LGDNLKMKIQILLH
Download sequence
Identical sequences ENSVPAP00000004382 ENSVPAP00000004382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]