SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004670 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004670
Domain Number 1 Region: 311-409
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-18
Family I set domains 0.0077
Further Details:      
 
Domain Number 2 Region: 34-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000181
Family I set domains 0.095
Further Details:      
 
Domain Number 3 Region: 241-311
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000599
Family C2 set domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004670   Gene: ENSVPAG00000005035   Transcript: ENSVPAT00000005035
Sequence length 537
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2943:72484:111572:-1 gene:ENSVPAG00000005035 transcript:ENSVPAT00000005035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVRAPEPQVLVFLGALLARWVAAGLEAAVIGEVHENITLHCGNISGPRGLVTWYRND
SEPVFLLSSNFSLPPAEPRFSLVNASSLHIEALSLQDEGNYTCQEVLNETRWFRVWLQVA
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPSAPQCWAEMSPGLFM
LQLTCRWAGGYPDPDFLWTEEPGDAVVGTSKLGVEMLNQSQLSDGKKFKCVGSHIVGPES
GASCVVQIRSPSLLSEPMKTCFVGGNVTLTCQVSGAYPSAKILWLRNLTQPEGVIQPNSH
YLITQSGQSSTLTIRNCSQDLDEGYYVCRAENPVGVREVDIWLSVKEPLNVGGIVGTIVS
LLLLGLAIISGLMLYYSPVFCWKGGREIRRQDMGDVMVLVDSEEEEVEGEEDAAEEEEEE
ADEREESPKEITKYGHIHRVTALVNGNVDQVGSGLQALQDDSSEQQSDSPHEKDRPV
Download sequence
Identical sequences ENSVPAP00000004670 ENSVPAP00000004670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]