SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004878 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004878
Domain Number 1 Region: 21-286
Classification Level Classification E-value
Superfamily L domain-like 2.19e-43
Family Ngr ectodomain-like 0.0087
Further Details:      
 
Domain Number 2 Region: 287-381
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-18
Family I set domains 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000004878
Domain Number - Region: 421-462
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00262
Family Fibronectin type III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004878   Gene: ENSVPAG00000005254   Transcript: ENSVPAT00000005254
Sequence length 466
Comment pep:known_by_projection scaffold:vicPac1:scaffold_4509:38572:39969:-1 gene:ENSVPAG00000005254 transcript:ENSVPAT00000005254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHIGRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWGSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASVLTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVTPDDRLVGNSSRTAVYDNCTLDILITTSQDSGAFTCI
AANAAGEATATVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGSGGSGGGEPPKS
PPERAVLVSDVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIY
Download sequence
Identical sequences ENSVPAP00000004878 ENSVPAP00000004878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]