SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004919 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004919
Domain Number 1 Region: 197-289
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000000000606
Family Complement components 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000004919
Domain Number - Region: 9-49
Classification Level Classification E-value
Superfamily E set domains 0.0882
Family SVA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004919   Gene: ENSVPAG00000005299   Transcript: ENSVPAT00000005299
Sequence length 307
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2603:135283:137782:1 gene:ENSVPAG00000005299 transcript:ENSVPAT00000005299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVSDPFELTVTKSFFVDLKLPFSVIRNEQVQIQAVLYNFRGNSVKVRVEFPYKEPLCSA
AKPGAPSRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGGYKGSEADISLTALVLIALNEGKELCNQENLAASMKQACDFL
EKKLPHIETTFAIAVVSYALALTGSPQANDRLDSFASQGGCGSLLNQPQSRGRDGVISNP
AMYDSSF
Download sequence
Identical sequences ENSVPAP00000004919 ENSVPAP00000004919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]