SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005493 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005493
Domain Number 1 Region: 454-578
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.37e-34
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 80-152
Classification Level Classification E-value
Superfamily WGR domain-like 1.44e-22
Family WGR domain 0.001
Further Details:      
 
Domain Number 3 Region: 314-363
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.0000000000392
Family Domain of poly(ADP-ribose) polymerase 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000005493
Domain Number - Region: 364-402
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000144
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005493   Gene: ENSVPAG00000005917   Transcript: ENSVPAT00000005917
Sequence length 582
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1536:98556:109840:1 gene:ENSVPAG00000005917 transcript:ENSVPAT00000005917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRRGASSGRARALNEGERVGNGKAATEDPPPAKKARRCRRQGVRKEPVAGGKADNDR
TEDRQDDWPGGSLASKRVSQSVKTLLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQ
TNLQFNNNKYYLIQLLEDDVQRNFSVWMRWGRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLRTPPLIRTEKELSDKVQLLEALGDIEIAIKLVKTELQSPEHPLDQH
YKKLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGKGIYFADMSSKSANYCFATRLKD
TGLLLLSEVALGQCNELLGANPEAEGLLQGKHSTKGLGKIAPSPVRSITXXXXXXXXXXX
SDTGILNPEGYTLNYNEFIVYNPNQVCMRYLLKVRFNFLQLW
Download sequence
Identical sequences ENSVPAP00000005493 ENSVPAP00000005493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]