SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005552 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005552
Domain Number 1 Region: 229-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 149-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 266-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 4 Region: 190-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 112-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 306-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000531
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005552   Gene: ENSVPAG00000005980   Transcript: ENSVPAT00000005983
Sequence length 359
Comment pep:novel scaffold:vicPac1:scaffold_1381:140281:221386:-1 gene:ENSVPAG00000005980 transcript:ENSVPAT00000005983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLLRCTPEKVSAKLRAAAEAAAQDWQTWGAGSGGTEAELRGVARGCERQKQEEKRRKWG
SSVGTPSPCGSAQAAAAAEEATEKMPALRSAPLWALLALWLCRAAPARALQCRDGYEPCV
NEGICVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCAPGF
TGEDCQYSTTHPCFVSQPCLNGGTCYVLSRDAYECSCQVGFTGKLCQWTDACLSHPCANG
STCTTVANQFSCTCLAGFTGQKCETDVNECDIPGQCQHGGTCLNLPGSYQCQCPQGFTGQ
HCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGTVRRETELWEKGRAWNGKERSENS
Download sequence
Identical sequences ENSVPAP00000005552 ENSVPAP00000005552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]