SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006190 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006190
Domain Number 1 Region: 1-117,143-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.65e-18
Family Nucleotide and nucleoside kinases 0.0063
Further Details:      
 
Domain Number 2 Region: 212-267
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000334
Family Nucleotide and nucleoside kinases 0.015
Further Details:      
 
Domain Number 3 Region: 120-148
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000827
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006190   Gene: ENSVPAG00000006666   Transcript: ENSVPAT00000006666
Sequence length 421
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2486:4207:132788:-1 gene:ENSVPAG00000006666 transcript:ENSVPAT00000006666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKIVILGPPASGKTTIAMWLCKHLNSNLLSVANLMAKEFSSLAADARRHYQKFKXXXXXX
XXXXXXXXXXXXXXXXXGWILDGIPETREQALMIQTLGIVPRHVIVLSAPDTVLIERNLG
KRLDPQTGEIYHTTFDWPPESEIQNRLMVPAGISEGETAQKLLEYHRNITRILPSYPKIL
KVIPADQPCVDVFSQALTYVQSIHRSNAPFTPRVLLCGPVGSGKSLQAALLAQKYGLVNV
CCGQLLKEAVADKSKYCEMILPFFEKEAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHRKDRPQGREIQARL
LQNPKDDDDRIKFRKDNIYRNAEDVEQFYRQAITLNGDQDPYTVFEYIESGIINPLPKKV
P
Download sequence
Identical sequences ENSVPAP00000006190 ENSVPAP00000006190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]