SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006330 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006330
Domain Number 1 Region: 936-976,1015-1129
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-25
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1137-1265
Classification Level Classification E-value
Superfamily FAS1 domain 4.58e-22
Family FAS1 domain 0.0061
Further Details:      
 
Domain Number 3 Region: 338-504
Classification Level Classification E-value
Superfamily FAS1 domain 7.46e-18
Family FAS1 domain 0.0036
Further Details:      
 
Domain Number 4 Region: 520-624
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-16
Family FAS1 domain 0.0029
Further Details:      
 
Domain Number 5 Region: 1486-1534,1615-1692
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000000981
Family FAS1 domain 0.0031
Further Details:      
 
Domain Number 6 Region: 1557-1596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.047
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006330
Domain Number - Region: 2422-2446
Classification Level Classification E-value
Superfamily FAS1 domain 0.00085
Family FAS1 domain 0.01
Further Details:      
 
Domain Number - Region: 234-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 198-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Merozoite surface protein 1 (MSP-1) 0.036
Further Details:      
 
Domain Number - Region: 1822-1880
Classification Level Classification E-value
Superfamily FAS1 domain 0.0275
Family FAS1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006330   Gene: ENSVPAG00000006811   Transcript: ENSVPAT00000006813
Sequence length 2546
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1525:86958:248258:1 gene:ENSVPAG00000006811 transcript:ENSVPAT00000006813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLQNFILFFFGLVVQNLCSPPETTEQAKRCDKKSLLTIRTECQSCSLNFGIKCPDGYTK
ITSGTVGIRDCRNTFEVRTYSLSLPGCRHICRKDYLQPQCCPGHWGPDCMECPGGARSPC
SGRGNCAEGMDGNGSCSCQEGFGGTACEACADDNLFGPSCSAVCTCVHGVCRSGIDGDGT
CECYSAYTGPNCDKPIPECATLLCPENSRCSPSSEDETKLECKCLPDYKSDGKYCEPINS
CLQNICHPLVRCTYLGPNRHICTCQEGYRGDGQVCLPVDPCQVNFGNCPTESTVCRYDGP
GQSHCECKEHYRNFVPGVGCSMTDACESHNPCHRNADCTTIAPGQTKCTCRKGYTGDGST
CYGNIMERLRELNTEPRGKWQGRLTSFISLLDKVYAWPLSNLGMFTVLLPTDKGLKGFNI
KELLMDNEAAQYFVKLHIIAGQMNTEQMSNTDTFYTLTGKAGEIFSGDKDNQLKLKLYGG
KRKVKIIQGNIVASNGLLHILDRAMDRVAPTFESNTEQTIMTMLQPRYSKFRSLLEETNV
GHVLDEDAVGGPYTIFVPSNEALNDMKDGTLDYLLSSEGSRKLLELVRYHIVPFTQLEVA
TLVSTPHIRSMANQIIQFNTTDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCADGHDGNGTCVCQEGFQGSQCQFCSD
PDKYGPQCDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXCVCKAGYEGDGILCSEMDPCLGLASGGCSRNXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNECECKKGFHGNGIDCEPIISCLEQ
TGKCHPLATCQFTSSGVWSCVCQEGYERRRLLCYGNAAVXXXXXXXXXXXXXXXXNASLQ
PMLSAAPNLTVLVPSQQAIEEMDQDEKAFWLTKSNIPTLIKYHTLLGTYGVADLQALSPL
DMLATSLQGNFLHLAKSDGNITIEGASVIDGDNAATNGVIHIINKVLVPQRGLTGSLPNL
LTRLDQMPDYSIFRGYIIQYNLASVIEAADAYTVFAPNNDAIESYIQEKKVATLEEDVLR
YHVVLEEKLLKNDLHNGMHRDTMLGSSYPLGFFLHNDQLYVNEAPINYTNAATDKGVIHG
LGKVLEIQKNRCDINDTTVIRGKCGKSSPICPFGTKPLSEETRRCLYTIYFMGKRSLFIG
CQPKCVKTVITRECCAGYFGPQCQPCPGRAENVCFGNGICLDGINGTGMCECGEGFNGTA
CETCAEGKYGIHCDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITKDDCKGTCHT
SAXXXXXXXXXXXXXXXXXXXXXXXXXXXINACEISNGGCSAKAVCKRTTPGRRVCVCKA
GYAGDGIVCREINPCLENNGGCHKYAECTQTGPNQAVCNCLLKYTGDGKVCTLIDVCLTK
NGGCSEFALCNHTGQGERTCTCKPNYIGDGFTCRGNIHQXXXXXXXXXXXXXXXXEHSVQ
DLIGPGPFTVLAPLSSAFDEEPRVKAWDEQGLMAQVLRYHVIACHQLLLENLKLTPNATS
LQGESIAISVSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ
NLTTVAINHGYIKFSNLIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVLAVDLPRSATWKTLQGSELSVKCGAGSDIGELFLNGQTCRI
VQRELLFDLGVAYGIDCLLIDPTLGGRCDAFTAFDVSXXXXXXXXXXXXXXXXXXXGKKQ
KCLYDLPYRRNLEGCKQQCTLVIQLPKCCKGYFWPDCQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGCSDHGQCDDGITGSGQCVCESGWTGRFCD
KQTVLPPVCTPPCSAHATCKENNTCECNLNYEGDGITCTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXETRFVDGRAIQWDIFASNGIIHVISRLKAPPTPVXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDPEDQPLGSSDPLGAL
Download sequence
Identical sequences ENSVPAP00000006330 ENSVPAP00000006330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]