SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006439 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006439
Domain Number 1 Region: 52-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-61
Family Calnexin/calreticulin 0.0000000948
Further Details:      
 
Domain Number 2 Region: 290-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.4e-45
Family P-domain of calnexin/calreticulin 0.00000162
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006439
Domain Number - Region: 402-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000348
Family Calnexin/calreticulin 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006439   Gene: ENSVPAG00000006926   Transcript: ENSVPAT00000006926
Sequence length 610
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2070:323094:363296:-1 gene:ENSVPAG00000006926 transcript:ENSVPAT00000006926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFQGFQLCLGLLFISINAEFMDDSVEMEDFDENSEEIDANEDVLSSEIKYKTPQPIGNV
YFTETFDSGRLAGWVLSKAKKDDTDAEISIYDGRWEIEELKENRVPGDRGLVLKSRAKHH
AISAVLAKPFVFADKPLVVQYEVNFQDGIDCGGAYIKLLADTDGLNLENFYDKTSYTIMF
GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEDWDESEP
AQIEDSSVVKPDGWLDDEPKFIPDPNAEKPEDWNEDMDGEWEAPRISNPACQIGCGEWHP
PMIDNPKYKGVWRPPMIDNPNYQGVWSPRKIPNPDYFEDDHPFLLTSFCALGLELWSMTS
DIYFDNFIICSEKEVADRWAADGWGVKIMVENANEPTVFKQLMAATEDRPWLWLIYLVTA
GLPVALITLFCWPRKVKKRYEDVEFKKTDICKQQTKGALEQEVKEEKAALEKPVDLEEEK
KESDGEILEKEEEGEPEEKSEEEIEIIEGQEEGNKSNKSGSEDEMKEADESTGSGDGPVK
SVRKRRVRKE
Download sequence
Identical sequences ENSVPAP00000006439 ENSVPAP00000006439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]