SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007403 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007403
Domain Number 1 Region: 293-391
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-32
Family Second domain of FERM 0.00000725
Further Details:      
 
Domain Number 2 Region: 213-292
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-26
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007403   Gene: ENSVPAG00000007959   Transcript: ENSVPAT00000007959
Sequence length 877
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_356:311358:413807:-1 gene:ENSVPAG00000007959 transcript:ENSVPAT00000007959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGATSEVKKESDQLGADATKEKPKEVAENQQNQPSDLEEEKGPQSSPTAESQSSTR
PQKKKAKSPSASRGVSRFIPPWLKKQKSYDLVVAKDGGDRKEPSQAVVEEQVLDKEESLP
EEEQLAKGDADETAQRKQQEMKADVKEEKPSVSGLETQPVEAVSKEREEEKVKEIQEDKL
DEAAKRETKEVQTNELKAEKASQKGPKKTKTVQCKVTLLDGAEYTCDLEKRAKGQVLFDK
VCEHLNLLEKDYFGLSFQEIPEQKNWLDPAKEIKKQLRSLPWLFAFNVKFYPPDPSQLTE
DITRYFLCLQLRQDIASGRLPCSFVTHTLLGSYILQAELGDYDPEEHGSNDLSDFQFAPS
QTKELEEKVAELHKTHRGLSPAQADSQFLENKRLSMYGVDLHHAKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRA
SKNLDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXDLDKAQEEILKHQASISELKRNFMESTPEPRPNEW
EKRRITPLSLQTQGPDTQAGAVTAVKTVIQENVVAPQMPAEKSVKEGVVKHYMRKEPDEP
NKMNEKVSHVDIDVLPQIICCSQPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITY
ESPQIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKXXXXXXXXXXXXXXXXXXXXXXX
XXXXALAQAIREAREQHPDMSVTRVVVHKETELEEGE
Download sequence
Identical sequences ENSVPAP00000007403 ENSVPAP00000007403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]