SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007710 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000007710
Domain Number - Region: 273-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000561
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007710   Gene: ENSVPAG00000008287   Transcript: ENSVPAT00000008287
Sequence length 622
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3104:3253082:3321843:-1 gene:ENSVPAG00000008287 transcript:ENSVPAT00000008287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMRKLHEIQISTGAIKVTET
RTGPLGCNSYDNLDSVSSVLLQSTESKLHLRGLQIIFPQYLQEKFVQSALSYIMCNGEGE
YVCQNSQCGCQCAEEFPQCNCPITDIQVMEYTLANMAKAWAEAYKDLENSXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTTLCQRPIPCIIGGNNSCA
MCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETDLDFQDLELKYLLQKMDS
RLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHMVIGMSMRICQMRNSSLD
PMFFVYVNPFSGSHSEGWNMPFGEFGYPRWEKVRLQNSQCYNWTLLMGNRWKTFFETVHI
YLRSRTRLPSLLRNETGQGPVASDPSKRQFYIKISXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXILKQSDQLTKLC
Download sequence
Identical sequences ENSVPAP00000007710 ENSVPAP00000007710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]