SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008726 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008726
Domain Number 1 Region: 529-715
Classification Level Classification E-value
Superfamily Bet v1-like 8.1e-30
Family STAR domain 0.0043
Further Details:      
 
Domain Number 2 Region: 89-248
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-28
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008726   Gene: ENSVPAG00000009378   Transcript: ENSVPAT00000009378
Sequence length 716
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1863:245546:373009:-1 gene:ENSVPAG00000009378 transcript:ENSVPAT00000009378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHGGVPIPPSPLSAPPTFLPGVTREGRRGLSSGGGPGRSAGVTATAAAAAAAAADAWKG
RVPSPLVLLPRSAWCQERRRRRGGRTSLRQLPPAPEQALLPSPSPDPSPRGLGASSGAAQ
GAGAGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVL
KNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQ
WIDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETF
RDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKV
FPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKRRRT
EEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTY
SLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDV
RNDWETTIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWI
VCNFSVDHNSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANV
Download sequence
Identical sequences ENSVPAP00000008726 ENSVPAP00000008726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]