SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009122 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009122
Domain Number 1 Region: 11-163
Classification Level Classification E-value
Superfamily E set domains 9.8e-26
Family Arrestin/Vps26-like 0.021
Further Details:      
 
Domain Number 2 Region: 172-329
Classification Level Classification E-value
Superfamily E set domains 1.12e-25
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009122   Gene: ENSVPAG00000009802   Transcript: ENSVPAT00000009802
Sequence length 408
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_368:2204297:2216118:-1 gene:ENSVPAG00000009802 transcript:ENSVPAT00000009802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT
ESRNAGSNTAYTQNYTEEVEYFNHKDILIGQERDDDNSEEGFNTIHSGRHEYAFSFELPQ
TPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIXXXXXXXXSPQAGTKEKT
LCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRVVVPKAAIYQTQAFYAKGKM
KEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVYVDIPGAMDLFLNLP
LVIGTIPLHPFGSRTSSVSSQCSMNMNWLGLSLPERPEAPPSYAEVVTEEQRRNNLAPVS
ACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSADDRPSCPSR
Download sequence
Identical sequences ENSVPAP00000009122 ENSVPAP00000009122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]