SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009859 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009859
Domain Number 1 Region: 426-696
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-75
Family Kelch motif 0.00000296
Further Details:      
 
Domain Number 2 Region: 159-275
Classification Level Classification E-value
Superfamily POZ domain 1.1e-26
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009859   Gene: ENSVPAG00000010591   Transcript: ENSVPAT00000010591
Sequence length 716
Comment pep:known_by_projection scaffold:vicPac1:scaffold_3434:32039:118972:1 gene:ENSVPAG00000010591 transcript:ENSVPAT00000010591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSGKKEFDVKQILRLRWRWFSHPSQGSPNTGNCLQQEGYEHRGTPVQGRLKNHSRDRN
GLKKSNSPVHHNILTPVPGPAPAHQRALQNWHPQNLIEHLRANEDTPKAVPEKTLFQEAC
EKHSQDLEMMADDNTEDSTARLDTQQPEEMNVSRSEEQFHAVNHAEQTLHKMENYLKKKQ
LCDVLLIAGHLRIPAHRWVLSAVSDYFAAMTNDVANDDVGMNGVDPNALNSLVQYAYTGV
LQLKEDTIENLLAAACLLQLTQVIEVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLSVAH
KYTMEHFIEVIKNQEFLLLPANEISKLLCSDDINVPDEETIFHALMEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLLADLENSSMFTGDLECQKLLMEAMKYHLLPERRPMMQSPRTKPR
KSTVGALYAVGGMDAMKGTTTIEKYDLRTNSWLHIGTMSGRRLQFGVAVIDNKLYVVGGR
DGLKTLNTVECFNPVGKIWTVMPPMSTHRHGLGVATLEGPMYAVGGHDGWSYLNTVERWD
HEGIQRKDVASMSNLRSTVGVVALNNKLYAIGGRDGSSCLKSMEYFDPHTNKWSLCAPMS
KRRGGVGVATYNGFLYVVGGHDAPASNHCSRLSDCVERYDPKIDSWSTVAPLSVPRDAVA
VCPLGDKLYVVGGYDGHTYLNTVESYDAQKDEWKEGVQDLLNTFYITPELKETLEH
Download sequence
Identical sequences ENSVPAP00000009859 ENSVPAP00000009859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]