SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010225 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010225
Domain Number 1 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 4.03e-25
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 318-378
Classification Level Classification E-value
Superfamily Kelch motif 0.00000111
Family Kelch motif 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010225   Gene: ENSVPAG00000010982   Transcript: ENSVPAT00000010981
Sequence length 632
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1181:128302:132607:-1 gene:ENSVPAG00000010982 transcript:ENSVPAT00000010981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKKTVKKNKSEINEMTIIVEDSPLSKLNALNGLLEGGNGLSCISSELTDASYGPNLL
EGLSKMRQESFLCDLVIGTKTKSFDVHKSVMASCSDYFYNILKRDPSTQRVDLNDIAPLG
LATVIAYAYTGKLTLSLYTIGSILSAAVYLQIHTLVKMCSDFLIREMSVENCMYIANIAE
TYSLKNAKAAAQKFIRDNFLEFAESDQFLKLTFEQINELLIDDDLQLPSEIVAFQIAMKW
LEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHKLLVDAMNYHLLPYH
QNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDVLYRDPENGWSKLTEMPAKSFNQCV
AVMDGFLYVAGGEDQNDARNQAKHAVSNFCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXEFSSVSSVPVSI
Download sequence
Identical sequences ENSVPAP00000010225 ENSVPAP00000010225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]