SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010381 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010381
Domain Number 1 Region: 306-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 418-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-23
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 3 Region: 474-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 519-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 1-42
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-18
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 7 Region: 264-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000012
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 118-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000236
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010381   Gene: ENSVPAG00000011149   Transcript: ENSVPAT00000011149
Sequence length 621
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3062:3513:6918:-1 gene:ENSVPAG00000011149 transcript:ENSVPAT00000011149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCVTFEDVTIYFSQEEWGLLDEAQRLLYCDVMLENFALIASRXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFCHGRDSEESPSELCVSVEVSQDMNPKAAPSIQKHY
PYDTCGLHLKDILHLAEHQATHPKQKPHVCEAYRKEFKFIANLHQQQMQQNGDKPIGRKA
GRAALVKGCSDDTSRKPFPLREGGKDFVARCGFLQRQAPPSVWEPHHSSEGVVDFPTVQC
RKKCSEFENALSDKPSLVQQRTPTGERLYECSKCGIFFSYAAGLFQHQRDHNRGKPYECC
QCGKFFSQHSSLIKHQRVHTGESPHVCSECGKFFSRSSNLIQHKRVHTGEKPYECSECGK
FFSQRSNLIHHKRVHTGKSAHECSECGKSFNCNSSLIKHWRVHTGEKPYKCNECGKFFSH
FDGLVQHQIVHSGERPYGCSVCGKAFSRSSDLLKHQRVHTGERPYECNECGKLFSQSSSL
NSHRRLHTGERPYQCPECGKFFSQRSSFNNHRRLHTGERPYECLECGKTFRQSSNLRQHQ
KVHKPDKPYKCSECGKAFSQRSTLIRHQKIHARERSSENVLSPSATQRHTLVISSENGLY
EVVSQKLNLVHPNIYAEEIPS
Download sequence
Identical sequences ENSVPAP00000010381 ENSVPAP00000010381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]