SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010442 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010442
Domain Number 1 Region: 53-517
Classification Level Classification E-value
Superfamily Sema domain 4.58e-164
Family Sema domain 0.000000000196
Further Details:      
 
Domain Number 2 Region: 513-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000994
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 580-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000236
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010442   Gene: ENSVPAG00000011215   Transcript: ENSVPAT00000011215
Sequence length 751
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_304:91054:258656:-1 gene:ENSVPAG00000011215 transcript:ENSVPAT00000011215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQAIWVLVGVFICSICVKGSPQPQARVYLTFDXXXXXXXXXXXXXXXXXXXXXXXLMD
EDQDRIYVGSKDHILSLNINNISQEPLSXXXXXXXXXXXXXXXXXXXXXHGCGNFVRVIQ
AFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPSVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKEKLTDNSRSTKHIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPIMYNSIYPVHRRPLI
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNSSASGELILEELEVF
KNHAPITTMKISSKKQQLYVSSNEGLSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCS
RFYPTGKRRSRRQDVRHGNPVNSCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQDSDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGE
ESQKMRGDYGKLKALINSRKSRNRRNQLPES
Download sequence
Identical sequences ENSVPAP00000010442 ENSVPAP00000010442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]