SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010511 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010511
Domain Number 1 Region: 1158-1336
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-51
Family DBL homology domain (DH-domain) 0.00000000765
Further Details:      
 
Domain Number 2 Region: 2022-2143
Classification Level Classification E-value
Superfamily PH domain-like 2.56e-32
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 1810-1978
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-31
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 4 Region: 1343-1403
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000274
Family Pleckstrin-homology domain (PH domain) 0.0000438
Further Details:      
 
Domain Number 5 Region: 722-820,1053-1109
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000175
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 6 Region: 567-667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000588
Family Spectrin repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000010511
Domain Number - Region: 4-45
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00379
Family CRAL/TRIO domain 0.013
Further Details:      
 
Domain Number - Region: 462-499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0131
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010511   Gene: ENSVPAG00000011289   Transcript: ENSVPAT00000011289
Sequence length 2144
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3646:220299:434687:1 gene:ENSVPAG00000011289 transcript:ENSVPAT00000011289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSK
FEFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFDWI
THNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDWIENHGEAFLSKHTGV
GKSLHRARALQKRHEDFEEVAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQ
QQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSISHIETVLQQLDEAQAQMEELFQ
ERKIKLELFLQLRVFERDAVDFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQ
YVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQA
EVKQVLGGIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTKERVKLLIQLADGFCEKGHAHA
AEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQLDIIPASIPGSEVK
LRDATHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIV
NKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDST
QLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCQEGKGEIKDGL
EVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEM
SLVFSKEVKDSSGRSKYLYKSKLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGEDLDSQGDGSSQ
PDTISIASRTSQNTLDSDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXRGRNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMA
IQQHSLLQPDSQDDKASSRLLVRPTSSETPSAAELVSAIEELVKSKMALEDRPSSLLVDQ
GDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVETERDYVRDLGYVVEX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFLGELEKCLEDPEKLGSLFVKHERR
LHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKPVQRIMKYQLLLKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKIVAQGKLLLQDTFLVTD
QDTGLLPRCRERRVFLFEQIVIFSEPLDKKKGFSMPGFLFKNSVKVSCLCLEENVENDPC
KFALTSRAGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLN
Download sequence
Identical sequences ENSVPAP00000010511 ENSVPAP00000010511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]