SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010758 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010758
Domain Number 1 Region: 313-559
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-58
Family Kelch motif 0.0000979
Further Details:      
 
Domain Number 2 Region: 46-145
Classification Level Classification E-value
Superfamily POZ domain 6.28e-30
Family BTB/POZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010758   Gene: ENSVPAG00000011559   Transcript: ENSVPAT00000011559
Sequence length 569
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_138:588660:608938:1 gene:ENSVPAG00000011559 transcript:ENSVPAT00000011559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGREFFDFSSGSSHAENILQIFNEFR
DSRLFTDVIICVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECF
LQYVYTGKVKITTENVQYLFETSSLXXXXXXXXXXXXXXXXXXXXXXXLGIQRFADTHSL
KTLFTKCKNFALQTFEDVSQHEEFLELDKDELIDYICSDELVIGKEEMVFEAVMRWVYRA
VDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPECYQLLHEARRYHILGNEMMS
PRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSGGRINGRDVWVYVVGGYDGQNRLSSVECYDSFSNRWTEVAPLKEAVSSPAVT
SCVGKLFVIGGGPDDNTCSDKVQSYDPETNSWLLRAAIPIAKRCITAVSLNNLIYVAGGL
TAIYCYDPVEDYWMHVQNTFSRQENCGMSVCNGKIYILGGRRENGEATDTILCYDPATSI
ITGVAAMPRPVSYHGCVTIHRYNEKCFKL
Download sequence
Identical sequences ENSVPAP00000010758 ENSVPAP00000010758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]