SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011038 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011038
Domain Number 1 Region: 4821-5035
Classification Level Classification E-value
Superfamily GFP-like 2.2e-64
Family Domain G2 of nidogen-1 0.00062
Further Details:      
 
Domain Number 2 Region: 2465-2564
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-25
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 1160-1257
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-24
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 4045-4142
Classification Level Classification E-value
Superfamily Immunoglobulin 5.23e-24
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 2573-2660
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 6 Region: 1815-1914
Classification Level Classification E-value
Superfamily Immunoglobulin 6.31e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 7 Region: 3212-3313
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-23
Family I set domains 0.0039
Further Details:      
 
Domain Number 8 Region: 4135-4233
Classification Level Classification E-value
Superfamily Immunoglobulin 9.96e-23
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 2384-2472
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 1080-1171
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 11 Region: 2671-2759
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 788-882
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 13 Region: 4318-4417
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 14 Region: 3117-3218
Classification Level Classification E-value
Superfamily Immunoglobulin 3.4e-22
Family I set domains 0.0065
Further Details:      
 
Domain Number 15 Region: 3957-4055
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 16 Region: 3414-3500
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 17 Region: 607-700
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 18 Region: 1351-1449
Classification Level Classification E-value
Superfamily Immunoglobulin 4.03e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 19 Region: 42-217
Classification Level Classification E-value
Superfamily vWA-like 5.68e-21
Family Integrin A (or I) domain 0.031
Further Details:      
 
Domain Number 20 Region: 1444-1542
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 21 Region: 1537-1635
Classification Level Classification E-value
Superfamily Immunoglobulin 6.73e-21
Family I set domains 0.005
Further Details:      
 
Domain Number 22 Region: 4404-4498
Classification Level Classification E-value
Superfamily Immunoglobulin 9.56e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 23 Region: 885-976
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 24 Region: 3307-3406
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-20
Family I set domains 0.0077
Further Details:      
 
Domain Number 25 Region: 1911-2008
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-20
Family I set domains 0.045
Further Details:      
 
Domain Number 26 Region: 4221-4319
Classification Level Classification E-value
Superfamily Immunoglobulin 5.85e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 27 Region: 2002-2101
Classification Level Classification E-value
Superfamily Immunoglobulin 6.45e-20
Family I set domains 0.0084
Further Details:      
 
Domain Number 28 Region: 3508-3593
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 29 Region: 1273-1355
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-19
Family I set domains 0.0031
Further Details:      
 
Domain Number 30 Region: 698-795
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 31 Region: 3773-3827,3912-3963
Classification Level Classification E-value
Superfamily Immunoglobulin 6.21e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 32 Region: 1628-1724
Classification Level Classification E-value
Superfamily Immunoglobulin 7.03e-18
Family I set domains 0.0047
Further Details:      
 
Domain Number 33 Region: 2950-3026
Classification Level Classification E-value
Superfamily Immunoglobulin 5.13e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 34 Region: 980-1068
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-17
Family I set domains 0.0082
Further Details:      
 
Domain Number 35 Region: 1760-1822
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000397
Family I set domains 0.024
Further Details:      
 
Domain Number 36 Region: 4498-4554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 37 Region: 4650-4705
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000366
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 38 Region: 5150-5263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000369
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 39 Region: 4705-4762
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000144
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 40 Region: 4762-4819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 41 Region: 3599-3690
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000112
Family I set domains 0.077
Further Details:      
 
Domain Number 42 Region: 5379-5433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 43 Region: 5263-5308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000948
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 44 Region: 3677-3728
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000183
Family I set domains 0.023
Further Details:      
 
Domain Number 45 Region: 2780-2820
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000544
Family I set domains 0.029
Further Details:      
 
Domain Number 46 Region: 5097-5148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.013
Further Details:      
 
Domain Number 47 Region: 2118-2148,2329-2378
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000321
Family I set domains 0.033
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000011038
Domain Number - Region: 3093-3124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000135
Family I set domains 0.031
Further Details:      
 
Domain Number - Region: 4555-4586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000275
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number - Region: 5421-5461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011038   Gene: ENSVPAG00000011859   Transcript: ENSVPAT00000011862
Sequence length 5585
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1109:541478:1001929:1 gene:ENSVPAG00000011859 transcript:ENSVPAT00000011862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWDIVHTVFLFALLYSSLARDASPQSDVRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTVTTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYWLAHEVLQLIQQKQSQVVFVLTGDCDDRDH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWKIPF
DPSLKEVTVSLSGPSPIIEIRDPLGKLVKKGFGLNELLNIHNSAKVVNVKEPEAGIWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVNRPVQGIPTFVLLNTSGISIPARVD
LLELLSISGSSLKTIPVKYYPDRKPYGVWNISDFVPPSEAFFLKVSGYDKDDHLFQRVSS
VSFSSIVPDAPKVTMPEKTLGYYLQPGRIPCTVESLLPFTLSFVRNGVRLGVDXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPPKVTVMPKNQSFTGGSEVSIMCAATGYPKPKIAWTMNDTFIVGSHRYRMTSEG
NLLIKNAVPKDAGIYGCLASNSAGTDKQTSTLRYIEAPKLIVVQSELLVALGDTTVMECQ
TSGVPPPQVKWFKGDLELRPSAFLIIDPLLGLLKIQETQDLDAGDYTCVAVNDAGRATGR
ITLDVGSPPVFIQEPADVSVEIGSNVTLPCYVQGYPEPKIKWRRLDNMPIFSRPFSVSSI
SQLRTGALFISNLWASDKGTYICEAENQFGKIQSQTTVTVTGLVAPLIGISPSVTSVIEG
QQLTLPCALLAGNPIPERQWVKNSAMLVQNPYITVRSDGSLHIERVRLQDGGEYTCVASN
VAGTINKTTTVDVHLPTIQHGQQILSTEGIPVTLPCKASGIPKPSIVWSKKGELISTSSA
KFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYVRPRVLGDQRGLSEDKP
VEISVLAGEEVTLPCEVKSLPPPTVTWARETQLISPFSPRHTFLPSGSMKITETRVSDSG
MYLCVATNIAGNVTQSVKLNVHVPPKIQRGPNVMKVRVGQRVDFPCSAQGTPVPVISWLK
DGNAVLVDGLQHMSNPDGTLSIHQATLSDAGTYMCVATNIAGSDETEITLHVQEPPTVED
LDPPYNTPFQERVASQRIAFPCPAKGTPKPTIKWLRNGRELTGREPGISILEDGTLLVIA
SVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKDQVTNVSVLVNQLTSLFCEVEG
TPSPIITWYKDDVQVTESSTVQIVNNGKILKLFKATPEDAGRYSCKAINIAGMSQKYFNI
DILVPPTIIGASSPSEVSVVLNHDTTLECQVKGTPFPVIDWFRDGKPLFLGDPNIELLDR
GQVLRLKNARRSDKGRYQCIVSNAAGKQAKDIKLTIYVPPSIKGGNVTTEVSALINSIIK
LECETRGLPVPTVTWYKDGQPVISSSQALYVDKGQFLHIPRAQVSDSATYKCQVTNIAGT
AEKSFHVDVYVPPTIEGDLAVPLNKQVVVARSLTLDCVAAGNPPPVLTWLKDGVPVKASD
NIRIEAGGKKLEITSALEVDRGQYICVATSVAGEKEIKYDVDVLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXWLKDGQLIDERDGFKILLNGRKLVIAQAQVSDTGLYRCV
ATNPAGDHKKEFEVTVHVPPTIKSSGPYERAVVKHKPVALQCVASGIPHPSITWLKDGQP
VSTAQGNLKIQSSGRVLQIARALMEDAGRYTCVATNAAGETQQHIQLHVHEPPRLEDAGK
MLNETVVVNNPIQLECKAAGNPLPAIMWYKDNHPLSGSTSVTFLNRGQIIDIESAQITDA
GIYKCVAINSAGATELFYSLQVHVPPSISGSNNMVTVVVNNLVRLECEARGIPAPSLTWL
KDGSPVAGFANGIQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVHPNI
MREEQNISVFISQAVELCQSDAIPPLTLWVKDGRPLLKKPGLHVTENGSMLKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREKGMEITEEGYIL
QLKNIHVSDTGRYVCVTVVAGMADRKYDISVHTPPSIIGNHRTPENISVVEKNSVSLTCE
ASGIPLPSITWLKDGWPVSLSSSARILSGGRTLRLMQTRIEDAGQYTCVVRNTAGEEGKI
FGLSVLVPPRIVGENTLEDVKVKEKQSVTLACEVTGNPVPEITWHKEGQLLKEDDTHHLM
SGGRLLQITNAQVSHTGRYTCLASNTAGDKSKTFSLNVLVSPTIAGVDGDGSPEDVTVIL
NSPTSLVCEAYSYPPATIAWFKNGSPLESDRNIRILPGGRTLQILNAQEDNAGRYSCVAT
NEAGEMIKHYEVKVYIPPLINKGDLLGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWY
KDGQPLKSDAHVTIGVNGHTLQIKETQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQ
KLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTSSDRVLILPX
XXXXXXXXXXXXXXXRYVCVGNEAGDSLQDIRVLXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXPPSVIGPNPENLTVVVNNFISLTCEVSGFPPPDLSWLKNEQPIKLNTNAL
IVPGGRTLQIIRAKVSDGGEYTCIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSDTGQYVCRAINVAGRDDKNFHLNVYV
PPSIDGPGKEVIVETISNPVTLTCDATGIPPPTIAWLKNHKPIENSDSLEVHILSGGSKL
QIARSQHSDSGNYTCIASNTEGRAQKNYMLSIQVPPDIAGAEIPSEISVLLGENVELVCN
ANGIPTPLLQWLRDGKPIANSETERIQVTADGSMLNIDGALPSDTGKYMCVATNPAGEED
RIFNLNVYVPPAIRGNKEEAEKLMALVDTSVNIECRATGTPPPQINWLKNGLPLPLSSHI
RLLSGGHVIRIVRAQVSDVALYTCVASNRAGVDNKHYSLQVLVPPNLDNGMGTEEVTIVK
GSSTSMTCFTDGTPSPRMTWLRDGQPLGLDTHLSISTQGMVLQLIKAETEDSGRYTCIAS
NEAGEVSKHFILKVLEPPHINGPEEAMELSVIVNNPLELPCIASGIPAPKITWMKDGRPL
PQMDQVQILGGGEVLRISNAQVEDTGRFTCLASSPAGDDDKEYLVRVHVPPNIAGTDESQ
DFTVLRNRQVTLECRSXXXXXXXXXXXXXXXXXXATPRVRILSGGRYLQVNNAELGDTAN
YTCVASNIAGKTTREFILTVNVPPNIKSGPQSLVIHLNKSTVLECSAEGVPTPRITWRKD
GAVLSGNNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPSIALG
PTNITVTINVQTTLACEASGIPKPSINWRKNGHLLNVDQNQSSYXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTIEIFATQLNHAGRYTCVARNAAGSAHRHVTLRVQEPPV
IQPQPSELDVILNNPVLLPCEATGTPSPFITWQKEGISVITAGRSHALLPHGGLQISRAV
REDAGTYMCVAQNPAGTALGKIKLNVQVPPVISPHPKEHTIAVDKPITLPCEADGLPPPD
IMWHKDGRAILESVRQRVLSSGALQIAFAQPDDAGQYTCMAANVAGSSSTSTELTVHVPP
RIQSTEEHYTVNENSQAVLPCLADGIPTPAIHWRKGNVLLANLLGKYTVEPYGELILENV
VPEDSGTYTCVANNAAGEDTHTISLTVHVLPTFTELPGDVSLNKGEQLRLNCKATGVPLP
KLTWTFNNNIIPAHFDSVNGHSELVIERMSKEDSGTYVCTAENSVGFVKAIGFVYVKEPP
VFKGDYPSNWIEPLGGNAILNCEVKGDPAPTIQWSRRGMDIEISHRIRQLGNGSLAIYGT
VNEDAGDYTCVAANEAGVVERSMHLTLQSPPVITLEPVETIINAGGKVILNCQATGEPHP
TITWSRLGHSIPWNERVKVLSNHSLYIAAAQKEDTSEYECVARNLMGSVLVRVPVIVQVH
GGFSQWSAWRSCSVTCGKGIQKRSRLCNSPSPANGGKPCQGSDSEMRNCQHKLCPGNRTR
TRTCNNPSAQHGGRPCEGSAVEILMCSIRPCPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGKWASWTSWSACTVSCGGGVRQRTRDCSD
PVPQYGGSACEGSDVQSDFCNSDSCPTHGNWSPWSGWGMCSRTCNGGQMRRHRTCDNPRP
ANGGRACGGPDSQTQRCSTDTCPVDGSWGNWHSWSRCLASCGGGEKTRRRLCNNPLPSKS
GRPCPGDATQVSRCNIQTCPGGPQRARGSVIGSINDVEFGIAFLNATVTDSPNSDTRIIH
ARITNVPRSLGPAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEIL
RMTHVARGLDSDGALLLDIVVSGYVLQLQSPAEVTVKDYTEDYQTGPGQLYASSTRLFTI
DGISVPYTWNHTVFYDQAQGRMPFLVETLHASSVESDYNQLEETLGFKIHASISKGERSN
QCPSGFSLDSFGPFCAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDE
CALGGHICHAGQDCDNTIGSYRCVVRCGIGFRRTSDGLSCQDINECQESNPCHHRCFNAI
GSFHCGCEPGYQLKGRKCLDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTC
IDIDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMDINECEQVPKPCAYQC
SNTPGSFECTCPPAQHLLGDGKSCAGLERLPNHGTQYSSSNPARFSPVRNSYQPRPHYRQ
YSHLYSSYSEYRNRRTSLSRTRRTVRKTCPEGSEATHDTCVDIDECEKRGICQHECKNTF
GSYQCICPPGYQLMLNGKTCQDVDECLEQNVRCGPNRMCFNVRGSYQCIDTPCPPDYRRD
PVLGFCLKNCPPNDLECALSPYALEYKLVSLPFGIAANQDLIRLVAYTQDGVMHPRTTFL
MTNEEQTVPFALRDENLKGVVYTTRPLREPETYRMRVRALSYSANGTVEYQTTFIVYIAV
SAYPY
Download sequence
Identical sequences ENSVPAP00000011038 ENSVPAP00000011038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]