SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011125 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011125
Domain Number 1 Region: 224-388
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.21e-33
Family SPRY domain 0.00025
Further Details:      
 
Domain Number 2 Region: 77-121
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000613
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011125   Gene: ENSVPAG00000011953   Transcript: ENSVPAT00000011954
Sequence length 389
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3324:101343:112763:-1 gene:ENSVPAG00000011953 transcript:ENSVPAT00000011954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWGDWRRQWLKRGAIPAERKASKVNAGVGERGIDATSGTGAQPSAYPKAVAVVAEGTAPR
RWLPMEAPELLGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARCWGTPPATG
PEASPTACRCCGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTLDPSTAHRRLLV
SADRRGVRLAPPGTPAPPDSPARFDQLPAVLGAQGFGAGRHCWEVETADAASCGDSSGED
EDHWESLYAVGAAGDSVRLKGRVGLCPAGAVWAVEGRGGRLWALTAPEPTPLGGAGPPPR
RIRVDLDWERGRVAFYDGRSLDLLFAFQA
Download sequence
Identical sequences ENSVPAP00000011125 ENSVPAP00000011125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]