SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011261 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011261
Domain Number 1 Region: 28-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.71e-27
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 263-328
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 471-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000143
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 677-749
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000115
Family VWC domain 0.029
Further Details:      
 
Domain Number 5 Region: 423-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 585-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000011261
Domain Number - Region: 385-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 761-797
Classification Level Classification E-value
Superfamily FnI-like domain 0.0251
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011261   Gene: ENSVPAG00000012109   Transcript: ENSVPAT00000012109
Sequence length 805
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2548:1242859:2114413:1 gene:ENSVPAG00000012109 transcript:ENSVPAT00000012109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRDVILVVCFCVCTARTVTGFGLDDQMDITELDVNTTLGVTQVSGLHNTSKAFLFQDIE
REIHAAPHVSEKLIQLFRNKSEFTFVATVQQKASTSGVILSIRELEHSYFELESSGLRDE
IRYHYMHSGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGTIQDGKIIFMQNGYITQCPNLNRTCPTCSDFLSLVQGIMDLQ
ELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWMDGDQCRNCTCKSGAVEC
RRMSCPPLSCSPDSLPVHIAGQCCKVCRXXXXXXXXXXXXXXXXXXXXXXXXXGGVLVKI
TEACPPLNCSEEDHILPENQCCSVCRGHNFCAEGPKCGENSECKNWNTKATCECKNGYIS
VQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQ
HNCDENAICTNTVPAHSCTCKPGYVGNGTTCRAFCEEGCRYGGTCVAPNKCVCPSGFTGS
HCEKDVDECTEGLVECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCVDIDECALRT
HTCWNDSACINLAGGFDCLCPSGPSCSGDCLHEGGLKRNGQVWTLKEDRCSVCSCDGKIF
CRRTPCDCQNPSVDLFCCPECDTRVTSQCLDQNAHKLYRSGDNWTHGCQQCRCLEGEVDC
WPLTCPSLGCEYTTILEGECCPRCVSDPCLADNIAYDIRKTCLDSYGLSRLSGSVWTMTG
SPCTTCKCKNGSVCCSVDLECLHNN
Download sequence
Identical sequences ENSVPAP00000011261 ENSVPAP00000011261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]