SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|PVX_003560 from Plasmodium vivax SaI-1 7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|PVX_003560
Domain Number 1 Region: 190-347
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 8.24e-35
Family Gametocyte protein Pfg27 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|PVX_003560
Sequence length 374
Comment | organism=Plasmodium_vivax_SaI-1 | product=hypothetical protein | location=CM000445:784081-785205(-) | length=374
Sequence
MLKKYIVVIYANLLLKTAFNSSPFGALALAIQTDREPSNTREEIISVNYESEEQDPSEAF
DYIEIVEYTDGGNVASVANDRYDNEQDVELQILNKSVRSEEERGTQKKEKEEKDVEEVEE
VEEVEVVEEEYDDDEDSEKDEEKESEAESDENEMSGEYIVQEVNDDVIVVQENINSIDEL
EDSLDSYRSLYSIFFVEFETTETYLNKIINCATDEEKNELLEDHIGILQEMYENNKKHDN
YRLPFELRDSMALRISDRLRDYCFSEPLTDSYVLTLKSIFSLELEVFKGLFYYVKHKSTY
SEKKEVINDLELIKFYHEELVTDNGLFLTDEQLDNAAMRVSNFVNDIYFLCFSNCQDMLI
FCQIREANDANITM
Download sequence
Identical sequences A5KBH4
5855.PVX_003560 gi|156093826|ref|XP_001612951.1| gb|PVX_003560 XP_001612951.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]