SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|PVX_085095 from Plasmodium vivax SaI-1 7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|PVX_085095
Domain Number 1 Region: 112-250
Classification Level Classification E-value
Superfamily MTH1598-like 1.16e-44
Family MTH1598-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|PVX_085095
Sequence length 250
Comment | organism=Plasmodium_vivax_SaI-1 | product=hypothetical protein, conserved | location=CM000454:903207-903959(+) | length=250
Sequence
MKQPSSNEIVSLPQRGRRRVGRDSASSDGVESEDNGEQSGYDSAEEAGDSGKSGSSVHIE
GSYKSGSSIHIEGSYKSGSSVHIDCSDEASAQNVALPYAKKKIKDGRLEKTYHYEYLDHP
ADVILHSYGKTLRECFESACVSMFNYMCNLNKVETKISRHITARGGTLEDLLYNFLTECH
FLYGSEYIICKAVDILVFDQGSFFIEASAYGDVFSPDLHECGTEIKAITKHELRICFTED
LWEAFVLVDI
Download sequence
Identical sequences A0A0J9S785 A0A0J9T689 A0A0J9VC38 A0A1G4HIY3 A5K0W1
XP_001616685.1.43797 gb|PVX_085095 gi|156101984|ref|XP_001616685.1| 5855.PVX_085095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]