SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|PVX_086080 from Plasmodium vivax SaI-1 7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|PVX_086080
Domain Number 1 Region: 1207-1303
Classification Level Classification E-value
Superfamily LCCL domain 6.28e-25
Family LCCL domain 0.00061
Further Details:      
 
Domain Number 2 Region: 692-794
Classification Level Classification E-value
Superfamily LCCL domain 6.67e-23
Family LCCL domain 0.0022
Further Details:      
 
Domain Number 3 Region: 888-1027
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.07e-21
Family Pentraxin (pentaxin) 0.029
Further Details:      
 
Domain Number 4 Region: 533-649
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0022
Further Details:      
 
Domain Number 5 Region: 282-390
Classification Level Classification E-value
Superfamily LCCL domain 1.57e-18
Family LCCL domain 0.002
Further Details:      
 
Domain Number 6 Region: 1091-1196
Classification Level Classification E-value
Superfamily LCCL domain 0.00000000000000144
Family LCCL domain 0.0055
Further Details:      
 
Domain Number 7 Region: 158-261
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.00000000000000288
Family Lipoxigenase N-terminal domain 0.013
Further Details:      
 
Domain Number 8 Region: 404-520
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000379
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|PVX_086080
Sequence length 1306
Comment | organism=Plasmodium_vivax_SaI-1 | product=multidomain scavenger receptor, putative | location=CM000454:1810813-1814733(-) | length=1306
Sequence
MVTPKCLTTLLVLQLLFQLLPPLTTHAKEWCKAKFEFGKADYAECQGETENIAKYMIHTT
PVISSDVDLYANVSLVMSNGYGLKTKEIIIGSEEEGLLSKTFAVTTDVGSPEHVHVKLNS
AKKNWKCKKITIWKDYKYWVFDCTGLLNEKNSEGTYFLSGNKIYTAFVQTGKDVQAGTSG
TVEIVLLGNDKRSNTKVLHEGFTSGVLKKIKFQASDVGTLEDIILTNNASRDDPWYCDFV
KIKSDNKLYVFNVKSWIGHPYEKTVRVNIRADQSVDGGAAKDIDCHIRGNDLINMANLPQ
ALQSKVQIFKVRCPQNCQNAELSSVEGSSIHPSSTAICTSAIHDGALTPSGGSIIVTVGN
DLNQYHAVREKTNQIEAIDFITKADEPNFSFYTYRLESIDDVKSNVRIVDSFGKLSSLGR
LEIRRSDNTWGTVCKKGPNFTFSDDSAKRACADLGFPNGLYIKQMCFNLNGRNYCAGYKY
PFSSAGMVCSGNEKNLLQCNADDSSHCVDHHDDVIIQCLNQGSNTELVTDGMIRLVDATG
APTTNGIGRLEMFYNGSFGSVCSEGWVKEGEKIACRELGYTGLKGNGFSHHLCTNIAGEN
LCGHDADKINAVNVKCKGDEKSLQSCPHETHEDIYCSHDEDLVIGCSGGEDEEYAYGGGS
QVGGHNSHSVSTTGGLKKNFLNLEKKDFPRKIELTCFDKVVSIADLSSAQVGDVFLASCP
EKCNEEVGVIKGTFLYTFDSPICKAAIHAGVLSSNVADDLVLIISHKHHSFLGTKRNDVE
SHGFTGTSKSFSVSIPTRSIIQEERKSNRKYEGGNAAGESSNGDDLSDERGNDSLVAPPI
AKLPNGHLPARGLGTQPTFQWTPPTGFHGFNGKETDFVNCTNLPNEKYIKSLSNFTFIIY
FTLSGGGGNWRTLLSHSLCDGISISVNEENELIIEQNCNPHLIKTKFKPVLGQTYHLAVA
FNKTNKGVTLYINGKELTLEKAKYDFTLNGDLIIGRSNQTTTDYFIGSIHLVEVYKFVLA
DDEIRQSASAALSLDYLSRGSDGNYNGGGKNKRGKKKRGSNRKTVDGRQCTTPCKPKSII
NKELQINGEQINLSCQDDLLSHQFDGKIGSQFLVHCSDDCTKSKLIVKGSNNYYTPDSSI
CKAAIHAGVYRPNRKNGDENNSFIMRIVNGLFEYKAARGHLGIVSKSERQSQLRSFSVFP
ENDDNILTCSSNGHLFLNLPVGTKRTIMCPSGCDKMEGKIWGTNVYAPSSTLCKAAIHSG
VLSNQGGLVDLSLGSAVDEFTGSTQNGVESHSSARRSRSLTFSTHS
Download sequence
Identical sequences A0A0J9T5Q5 A5K1F5
gi|156102372|ref|XP_001616879.1| XP_001616879.1.43797 gb|PVX_086080 5855.PVX_086080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]