SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|PVX_094560 from Plasmodium vivax SaI-1 7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|PVX_094560
Domain Number 1 Region: 367-464
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 3.6e-16
Family Cdc48 domain 2-like 0.0018
Further Details:      
 
Domain Number 2 Region: 568-614
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-16
Family RING finger domain, C3HC4 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|PVX_094560
Sequence length 615
Comment | organism=Plasmodium_vivax_SaI-1 | product=hypothetical protein, conserved | location=CM000449:333387-335436(+) | length=615
Sequence
MESCRRGESKHMHFLSNVNSKKKLNIVEKKSILEKVHILPIKRKVENADPLYRELQLMIN
DKCVLYEGFIIAANGEKEKVPGGGNTRKGMKEDLTNDKAEGATKSENHITGTNLLEKLSS
DKEGTCPNGDPWEVAHRKESNSYAEKQNSSEKDRKNTPSNDHICLHEKRNKDKLADETSH
FKENTDYYVVVNCIPSKGILTRDTLIYTDGKYVDNLKKIHLIIIRDKYYKKYEKKLKKKF
FSLKKYILKKGNQFFNEAMSLIPFSFDHFSSKCSSERGKNNSTFGVKHGDTVTPRSSTMR
RRSLVLEKILLTCLHPYFKKNRTKLFYSGKLLLINNFSFLVVKIDADVNVGFVDNSTEIC
LNADAYDPFRNVHIVPLYDTLPTTYNYNIFADYIKPYIERHYLSLFSMHDTFFYKGVQFK
IMGIDPMNIKSGRGRITCNTFIYTEGAIKPTFFDVISNESINYIQCLPVEYKPYAVLNIL
QQLDADSLLRLFPSTNANLQESALNEQRILSHLDKYKYVYKNHTLEEGQGGKMLLDVDAG
EHIDAEKHIDAEKHIDAANKSDNFAYEQCAVCFEHFQDYDKCIKLACLHTYHWKCVKSWF
RFNLTCPCCRRELTI
Download sequence
Identical sequences A0A0J9SXH5 A5K794
gi|156096693|ref|XP_001614380.1| 5855.PVX_094560 gb|PVX_094560 XP_001614380.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]