SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00003574001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00003574001
Domain Number 1 Region: 137-469
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.44e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000042
Further Details:      
 
Domain Number 2 Region: 478-617
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.66e-22
Family Ricin B-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00003574001
Sequence length 644
Sequence
MRTVRIHVKSVIKLAVIFGCFGGIMFAMWPKTTEEFIRETENSYKNLKQRAFEIAASDGK
LRLEDIDPNSANGFPKLTKDEIGNYEPKDWKVPAGPGEGGVEPLKLDDSTEMQKKQKDAI
NEYGFNMVASDAISLDRYPADLRHEECKHYQYPESLPASSVIFVFHNEGWSTLVRSIHSV
INYTPPELLEEVVLIDDGSNKEHITGGRLEEHIKQWNGLVKLYRNDRREGLIRARSIGAR
KAVGSVLIYLDAHCEVEPNWIVPLVEPMVHDYRICTVPMVDAIDGATYVFTPQAGGDENN
FARGAWDWDLLWKRIPLNDRERARQEHMTSPYRSPAMAGGLFAISRKFFFELGLYDEGLD
IWGGENFEISYKIWMCHGQMLFVPCSRVGHIYRMKGWRGNGTPSYVKGNFVDRNYVRVVE
VWWDEYSKYFYERKPNAKHVDPGDLTEVKAVRERLQCKSFDWFMKEIGYDLPKHFPLVEP
SNAARGHITNVGTNLCVDGHHAGQGDQLALSECASVREGQWMLTWHEDIRPLSGSNVENK
KASDARKVCWDGTGVGNPIGFWECHTQGGNQLFKYVPDKKQFIHSPSRACATAHEEQKKV
YLKACDDSNDNQKWWWDKQDDATLARQNKDMMNHIDPPELDYLS
Download sequence
Identical sequences E4X7N5
GSOIDT00003574001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]