SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00005866001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00005866001
Domain Number 1 Region: 63-128
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000353
Family HMG-box 0.0025
Further Details:      
 
Domain Number 2 Region: 152-177,227-273
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000528
Family HMG-box 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00005866001
Sequence length 448
Sequence
MQHLHQMRMLQSFGQYSQLGFSGLNSSHFGSSPNSSDHSVFELKDGRSIGGGKAIESKKQ
KRKKSSNVKRPTTAYLYFVSKYREEVKNAGNSMPKQAKEMMQECAAKWRAMSDDEKKPYH
ELAGIDKVHLFVFKERWLNEKAAEKKPKDQWRPKRPPSAYFLFLKDFRANWKIDSANDTA
ESEDENENKLDIKNEDDEDRAKLSICENENEPQKKIKIDDDKAKKLNPQKEITKRAGSKW
NSMSEEEKAPYVAKALETRVKWEKQLQIYKNEIKNGKTGEQAAEKLNDLTEGGESALNEA
VADLPSKMLQAPLPENFVKNDVDSSSKLIRPDLSISDSPNAHQAVSSMPHAQSQLHSSPI
SAFPANLASLQQTASSIQHSEIMNQYLSHQNSEALSTSQTIFQNQSSFGHQNQQQTADHH
QPQQNHQSQFEPWQPSLFPGNADGHTQR
Download sequence
Identical sequences E4WT11
GSOIDT00005866001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]