SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00010377001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00010377001
Domain Number 1 Region: 220-542
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.08e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000123
Further Details:      
 
Domain Number 2 Region: 534-673
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-21
Family Ricin B-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00010377001
Sequence length 679
Sequence
MRRNSRILLLFGIIWFSGVYLYVRNSENTSGVFNAESNPRHGNRISKDAPAKHHKKDHKQ
KIKLVEDHNLDADKLEHDIQDIEHGLEDLKDSNDDEFAAIEDSIRHDLADDDDKDYADME
ALSEEDKDDENDAAKKESKAKAEPTGDSKINKEIAEEKTIQDKDELDKGENDEDYEDDGK
VDWWNFDDSAYLAAGALGADEDPYEANKFNQAASDRIKSDRAVPDTRHKECSKQKYQVEQ
LPDTTVIITYHNEAHSTLLRTVISVLHRSPPNLIKEIILVDDFSKNPNIGPPLTKIKKVK
AIRNPKREGLIRSRVRGAAIATGKVLTFLDSHVEANEGWLEPLLGRIHESRTAVVSPIID
VIGMDDFHYVGASADLKGGFNWDLVFKWDYMSEQERRERRRAPTSPIRTPMIAGGLFSID
KNWFHELGEYDMDMDVWGGENLEISFRVWQCHGTLEIIPCSRVGHVFRKKHPYTFPGGSG
NVFAKNTRRAAEVWMDEYKEFYFAAVPSAKMVKFGDISKRTEVRERLQCKSFSWFLENVY
PELRIPNKDAIGWGAVSQTNKGLEECIGNTHGGGTLGMYRCHGDGGNQEFTLTKEGKEFR
HNDLCIGYNAKEPVGNPVKFNTCHQMSHQRWEYFSSQIKPEGHTNLCLDSKNHLEKGLTL
EVCNHSKTQVFSFEMRNIK
Download sequence
Identical sequences E4XFX0
GSOIDT00010377001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]