SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00011049001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00011049001
Domain Number 1 Region: 416-752
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.06e-45
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000159
Further Details:      
 
Domain Number 2 Region: 744-815
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000891
Family Ricin B-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00011049001
Sequence length 827
Sequence
MPVAGIPNFVMEKKDPKVANGKEEFADYAEINSETEFEKEFDKSEKEEEITEFKEDDDLV
ENKKESKMPERVRFIKTKVEEDNVDEPYNIEGYKIPENHNTTIFDNVFKSEKYLTEGREY
NYYHLWHFQSTINDAKDEEIEEDYDDFLEELSFYSNDSTTKNITLRTQKKEQAMIKDIFD
VDVEVDDYAGYEFEPDHEIRREKEILKAEVENKIKRLKEQKQAEIDARIAQEEKLQKIRE
DQLRREKVLKDREEREKKREEFLRKKEEAAEVIALHRKLAAQKRLKDKMRAEDYEEEDEL
LKEEYETMQQVAERGQKKENVNERPIAGAEIFGQEKMFGLFKGRVLLEPGVPHDFYSDEE
LQPCLRKPLPRKSDPGEFGKGYVPENPTADEKAQIDKGWERHGFNEFVCNRIALTRHLSD
KRPSKCMSKRWKKPLPTTSIVIVFHNEATCTLLRTVYSILGTTPKILLTEIILVDDKSEI
DKRPELGVTLEQTIFDDINSKMGENFVKIIRQPTRLGLIQARLAGAAVAKGDTLTFLDAH
CECFPGWAEPLLERIAEDPTRVMTPVIEVIDAGTFRTGETKTANIFKGVFGWNLVFNWIE
AYGPKNPYTSAYEARPIRSPTMAGGLFTMDKAYFNWLGTYDEEMKIWGGENLEMSFRVTN
CSEFFNYHLCRFGCHVFREKSPYSHPGGEEPIMRNSIRVADVWLDEFKEVYFRRGAPILK
NIDPGNMSSRIQLRENLQCQPFSWYMENVLPELDYTMNDDLIFAGEIISQARNRTNRQCF
DSTGKDNAQIQIFPCHGLLGNQYYEYTNIKDIRYESKMQKFLVSNYL
Download sequence
Identical sequences E4XHR7
GSOIDT00011049001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]