SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00013206001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00013206001
Domain Number 1 Region: 149-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000233
Family Classic zinc finger, C2H2 0.079
Further Details:      
 
Domain Number 2 Region: 637-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000709
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 3 Region: 432-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000721
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 389-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000982
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 5 Region: 600-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000251
Family C2HC finger 0.084
Further Details:      
 
Domain Number 6 Region: 253-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000033
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 330-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000885
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  GSOIDT00013206001
Domain Number - Region: 800-825
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00014
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 90-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00018
Family Classic zinc finger, C2H2 0.06
Further Details:      
 
Domain Number - Region: 525-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000949
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 203-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.015
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number - Region: 478-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0299
Family Plant C2H2 finger (QALGGH zinc finger) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00013206001
Sequence length 868
Sequence
MPNFISDRLKKETQVEPKKPLFEKYVVNTDIKSIFCKYCNEAFYTDRACEMHISLAHDGD
IDREKRKRAKTKEEAEKMDVEEEEDLVNSFKCDEYPCKRKFPTWHGLKIHLKSSHKYTTA
DFALNCDTCGRKFSTKTSLENHIENAHYLKCEECDEKFQENHQLEAHIRRRHNKKVNKCD
QCGREFRSADTLRLHMEIHKKPEFDCMKCKRQFMTKGELDFHLMEHETDDKMKKLKEEAE
AAEASKKLFCDNPKCNKSFLTEKSFKMHMDMHAAEEDVRKECPKCHKTFMTEKSLNFHIE
NFHPDVDLDQVELDKSKGVNSYEQEYKKDGWKCDECHRFFDSKQIYEYHMTRHANTFKCK
ECPEKFKTRVTKQGLEMHMQEHQKKAVELHMCKVCSKEFDSAAMLRFHETTAHESQHDFE
CTKCGKMLSSESGLEMHMETHEFLESMEIKCQECGKKFSTERNLELHIETYHREEVIIKC
LYCDRQFDSDATIGIHMKHNHPEEYKQMQRMKQQENVNSAPVRERFKCPYEDCDATFRSE
NTLNLHVNNAHGFEDMEEFSVRMNAMTQNRIQETLDDLDIDMPKTHASRREPDPEPEPEP
RRFKCEECGSIYSSERTYEQHMEYIHPKDEKIPEPQWKCAECGKTFRIEAGYNLHMSNHK
QEKEQASLQCEHCEMSFDSDRQLSRHQRACVAKDQKDAREEAQKIRSRYETTRKPEVEPE
PVQRKSRYSIPEDSPEPIRKTPSSQVSNLDDDDDDYRPASPQFECNLCKEQMLKNVEKQK
FLSEMMQKYHDCPEKNDEPDEFKCDKCGKTYWSEKMLKIHSRTHISFDDTDEIDEGILNM
KIEMPAVKKQIRNAVDKLQTIAFKYLHS
Download sequence
Identical sequences E4WZ56
GSOIDT00013206001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]