SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00013336001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00013336001
Domain Number 1 Region: 123-449
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.38e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000000336
Further Details:      
 
Domain Number 2 Region: 453-581
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.38e-38
Family Ricin B-like 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00013336001
Sequence length 588
Sequence
MILRRRAGSVRIVILTSLFWITFFYWGAEIWCQTPSINLDERGSDFNGAGRGDEPAERSL
GELLGDGLNKVNDAVQKHIPGKGPGEMGAPVKIPKDKEKESKKMFQENQFNLMASNMISL
NRTLKDVRMSGCKKHDYANLGALPKTSIIFVFHNEAWSTLLRSIHSVINRSPREMLEEII
LVDDKSEKDFLGKQLDDYVKNLPVPVHIIRQQHREGLIRARLEGAKIAKGEVLTFLDAHI
EASPGWLEPLLYEIKKDRTNVICPIIDVISDDTFEFLTGSDLTYGGFNWKLNFRWYPVPQ
REVDRRGGDRSLPMQTPTMAGGLFSIDKSYFYEIGSYDSGMDIWGGENLEMSFRIWMCGG
TVLIATCSHVGHVFRKATPYTFPGGTSQIINKNNRRLAEVWMDDYKKFFYIVNPTVMKHK
YGDVSDRKTLRNDLQCKSFQWYLDNVYPDAQIPRRYKVLGEIKNTGANICLDTMGRKENK
KVGCYSCHGQGGNQVFSFTMDNEIRIDDLCLDVANSKGPVMMVKCHHQKGNQYWEYNIKT
NQLIHTNSKQCLTKPIARSANEPRMERCDGSIDTQKWSFRNMTVPGLE
Download sequence
Identical sequences E4WZH6
GSOIDT00013336001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]